Os02t0662000-01

Locus

Os02g0662000

Description

RCc3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RCc3, OsHyPRP01, HyP/GRP01, OsHyPRP1, HyP/GRP1, OsRcc3, HyPRP1

Oryzabase Gene Name Synonym(s)

root-specific RCc3, hybrid proline- or glycine-rich protein 1, Hybrid Proline-Rich Protein 1

Transcript Evidence

AK109149 (DDBJ, Best hit)

Protein Evidence

Q40721 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

002-155-F07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0662000-01)

RiceXPro (AK109149)

Others

Oryzabase (10211)

KEGG (Os02t0662000-01)

Transcript

833 bp

>Os02t0662000-01 RCc3 protein.
ATCTCAAGCAGCCTAATCATCTCCAGCTGATCAAGAGCTCTTAATTAGCTAGCTAGTGAT
TAGCTGCGCTTGTGATCGATCGATCTCGGGTACGTAGCAATGGCGTCCAAGGCGTTCGCT
CTGTTCCTGGCCGTGAACCTCGTCGTGCTCGGGGTGGCAAGCGCCTGCGGCGGCAGCCCG
TCGTGCCCGACGCCGACGCCGTCGACCCCGACACCGTCAACGCCGACGCCGACGCCGTCG
GCGTTCGGGAGGTGCCCCCGCGACGCGCTGAAGCTGGGCGTGTGCGCCAACGTGCTGGGC
CTGATCAAGGCCAAGGTGGGCGTGCCTCCGGCGGAGCCGTGCTGCCCGCTGCTGGAGGGG
CTCGTCGACCTCGAGGCGGCGGTGTGCCTCTGCACGGCCATCAGGGGCAACATCCTCGGA
ATCAACCTCAACCTCCCCATCGACCTCAGCCTCATCCTCAACTACTGCGGCAAGACCGTC
CCCACCGGCTTCAAGTGCTAAGCAGCGTGCATATGCAATGCCTGCATGGGTTGATCCTAC
GTACGGTGATTAGTTGGCTTTGACGACTCTTGATTTGATTTGCTTGCTGCTCTGTTTATT
TGCTACTACGTTACGTACGTACTTTGCATGCAACGCAACGCATGATCGATCGTGCATGCT
GGCTGTTTGTACGTATCACGGTACCAGTTTGGATTCTCTCTGTACTCTCTCCTTTGTCTT
CTTTGTAGTACTCTTATTCCCGCTATCCGTACGTGCGCATTTGTTGTAAGGGCCGGTGCT
AGCTTGTGTGCCGGTACCAACTTCTAATAAAGCTTTGGTTTGCAACTTCAGAT

CDS

402 bp

>Os02t0662000-01 RCc3 protein.
ATGGCGTCCAAGGCGTTCGCTCTGTTCCTGGCCGTGAACCTCGTCGTGCTCGGGGTGGCA
AGCGCCTGCGGCGGCAGCCCGTCGTGCCCGACGCCGACGCCGTCGACCCCGACACCGTCA
ACGCCGACGCCGACGCCGTCGGCGTTCGGGAGGTGCCCCCGCGACGCGCTGAAGCTGGGC
GTGTGCGCCAACGTGCTGGGCCTGATCAAGGCCAAGGTGGGCGTGCCTCCGGCGGAGCCG
TGCTGCCCGCTGCTGGAGGGGCTCGTCGACCTCGAGGCGGCGGTGTGCCTCTGCACGGCC
ATCAGGGGCAACATCCTCGGAATCAACCTCAACCTCCCCATCGACCTCAGCCTCATCCTC
AACTACTGCGGCAAGACCGTCCCCACCGGCTTCAAGTGCTAA

Protein

134 aa

>Os02t0662000-01 RCc3 protein.
MASKAFALFLAVNLVVLGVASACGGSPSCPTPTPSTPTPSTPTPTPSAFGRCPRDALKLG
VCANVLGLIKAKVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGINLNLPIDLSLIL
NYCGKTVPTGFKC*

5'UTR

chr02:26804988..26805086 (+ strand) : 99 bp

CDS

chr02:26805087..26805488 (+ strand) : 402 bp

3'UTR

chr02:26805489..26805820 (+ strand) : 332 bp

FASTA

>Os02t0662000-01 class=Sequence position=chr02:26804988..26805820 (+ strand)
ATCTCAAGCA GCCTAATCAT CTCCAGCTGA TCAAGAGCTC TTAATTAGCT AGCTAGTGAT TAGCTGCGCT TGTGATCGAT
CGATCTCGGG TACGTAGCAA TGGCGTCCAA GGCGTTCGCT CTGTTCCTGG CCGTGAACCT CGTCGTGCTC GGGGTGGCAA
GCGCCTGCGG CGGCAGCCCG TCGTGCCCGA CGCCGACGCC GTCGACCCCG ACACCGTCAA CGCCGACGCC GACGCCGTCG
GCGTTCGGGA GGTGCCCCCG CGACGCGCTG AAGCTGGGCG TGTGCGCCAA CGTGCTGGGC CTGATCAAGG CCAAGGTGGG
CGTGCCTCCG GCGGAGCCGT GCTGCCCGCT GCTGGAGGGG CTCGTCGACC TCGAGGCGGC GGTGTGCCTC TGCACGGCCA
TCAGGGGCAA CATCCTCGGA ATCAACCTCA ACCTCCCCAT CGACCTCAGC CTCATCCTCA ACTACTGCGG CAAGACCGTC
CCCACCGGCT TCAAGTGCTA AGCAGCGTGC ATATGCAATG CCTGCATGGG TTGATCCTAC GTACGGTGAT TAGTTGGCTT
TGACGACTCT TGATTTGATT TGCTTGCTGC TCTGTTTATT TGCTACTACG TTACGTACGT ACTTTGCATG CAACGCAACG
CATGATCGAT CGTGCATGCT GGCTGTTTGT ACGTATCACG GTACCAGTTT GGATTCTCTC TGTACTCTCT CCTTTGTCTT
CTTTGTAGTA CTCTTATTCC CGCTATCCGT ACGTGCGCAT TTGTTGTAAG GGCCGGTGCT AGCTTGTGTG CCGGTACCAA
CTTCTAATAA AGCTTTGGTT TGCAACTTCA GAT

Locus: Os02g0662000

Loading...

Locus: Os02g0662000

Loading...