Os02t0665800-01

Locus

Os02g0665800

Description

UspA domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK81

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 81

Oryzabase Gene Symbol Synonym(s)

OsPUB55, OsRLCK81

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 55, U-box protein 55, Receptor-like Cytoplasmic Kinase 81

Transcript Evidence

AK243162 (DDBJ, Best hit)

Protein Evidence

A2X833 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Functional domain (InterPro)

UspA (IPR006016)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Full-length cDNA

J100034K17 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0665800-01)

Others

Oryzabase (17846)

Transcript

3377 bp

>Os02t0665800-01 UspA domain containing protein.
GTAACTTGATCTCGAAATTTCCATTCATGAAACGGCTGGGCAGTTACTCTGCAGCTGCAT
GGTCTTGTGCTTCTCATTTCTCAACGTCAGGAAGCAGCAATGGATAGCGACGGCGAAGAG
TACGACGCGATGTGGAGCGCTCGGTGCAGCGTCAGCTCGTCGGCCGGCTCTCTGCAGGAC
GCCGGCGACCAGTGGGACGAGCAGAGCCTGGCCGCCGGCGAGGACAAGGTGTTCGTGGCC
GTCGACGAGGACGTCGAGCACGGCAAGAGCACATTCCTTTGGGCGCTGCAGAACCTGTCC
ACGGACGGGGCCAATATTGTAGTTGCTCATGTCCACAGCCCTGCACAAACTCTCAGTAAA
GTTCACTGTACCAGAATGAAGCCTGAAGAGATCAGCGAGTACCTGATGTTGGCGAAGGAA
GAGGCCGAGAAGAACCTAGATGAATATGCTCTGATAGCGAAAAGCACAGGAAAAGATATG
AAGACTGATTGTCAGAAAGTACTAATTGACATGGACGATGTCGCAAAAGGACTCGAGGAA
CTTATTACCCTTCATGGCATCACCAGGCTTGTCATGGGAGCAGCCGCAGACCAACACTAC
TCAGAGGAAATGAAAGAACCAAATTCCAAGATAGCCCTCAAGCTGATGGAGACTGCATCC
CCATCATGCAAGATATGGTTTACCTGCAATGGCCATCTGATATGCACAAGGGAACCCAAT
GAAAACCTTCTTGCAATATATGTGCCGCCTGCACAAAGCAACACGGTACCATTGTCAATG
TGCAGCATTTCAAGCCAAATGAGTTCGATAGAGCTGAAGAAAGAAGCACCAAGCTCAGAA
GAATATACTTTAAGATCATTGGCTCAATCGGCAATGAGTGATTGGGACTACATTTTCGGG
GATTGGGGAAGGACAGGGTATGGTTCATTAAGGACTGATGATGCAATAAGTATTCCTGAA
GCCACAACTCTAGCTGCGATTGTTGACGATACAAACAAACAAAGATCAGTGATGCACTCT
CCTCAGGAATCTGACAGTGTCAATTTCTCATCACCAGCTTGTGATCCCCAACAAGAAGAA
GAAGAACCAAATTTAGATGAAGACATGCATGATATACTTAATGAGGCATGCACTCGAGCT
GAACTACTCAAGAAAGAAGTTGATGGTGAATCTAGCAAGCGTCGCAAAGCTGAAATGGAT
CTACTTATAGCTCTTCAGAGAGTTCAAGAGTCAGAAAAATCATATCTACAGGAGGTGAAC
CAGCGGAAAGAAACTGAGAGGACACTTGCAAGACAGAGGCTGGAGATCGATGAAATGAAA
AGGCGACACAATACATTATATGATGAACTACAGGATACAAAGAAACAGAAGCTTCTGCTG
GAGCAACATATATCTGAGATTAAATCTGCTGCAAAAGATTATGTACAAGAGATTACTGAA
TATTTTATACAAGAATCATGTGAGGAAGCCAAGAAATTCCAAAAGATCAAGATGGATCTG
CTTGCGATGCTTCAAAGAGTTAAAGATGTGGAGAATTTAAACCGAAATGAAAAGATGCAG
AGGAAAGATATGGAGGAAAAGATTGCAAGACAGAGGATGGAGATTGAAGAAACAAAAAGG
CAGCGAGATGAATTATACCATGAGTTAAAAGATGTAAAGGAACAGAAGCTCTGTCTGGAA
CGACTTGATTCATCTAAAGAAACTAAGAGGAGAAGAAAAGCTGAGAGCGAGATGCTCTCC
GCTCTTAAGAAGGTAAGATACTAAGACGTTTGTTTCAGTGGTCTGTACTCAGTACTATGA
ATTGCAGGTTTGTCATGAAAATGTGGAGTACTCTTACAGGTTCATGACCTGGAGCATCAG
TATCTGAATGAGTTGAAAAGGCGGGAAGCGGTGGAGGAGACATTTGCACGGCAAAAAGAG
GAAATTCAAGAAACGAAAAGAGAGCTAAACAAGATACGTAGCAGACATATGACAGAGATC
AAAGCTCATGAAGAAAAGCTTGCAGAAAGCATCCGCTTTATCCAAAAGATTCAAGCAAAG
TATGACAAAACACTACATGAGAGAGACACTGCCATAGCAGAATCTGAAAAATTGCGCCAA
ATGAACAGGGATGGAGCTTCAATGATAGCAACCACCCAGATCGCCGACTTCTCTTTTTTT
GAGCTGCGGCAAGCAACCCAAGACTTTGATACGGCACTCAAGATTGGCACAGGCAGATTT
ATGAATGTGTACAAAGGGTTCATACGGAACACGGCTATAACTGTAATGTTGCTTCATCCT
CAGGGCCTGCAAGGGCAGTTAGAATTCCATCAAGAGGTTGTTGTTCTCAGTAGACTGAGG
CATCCTAACGTCATGATGCTAATAGGTGCATGTCCGGAAGCTTTTGGCATGGTGTATGAA
TTCCTCCCAAATGGGAGCCTCGAGGACCAGCTCTCGTGCAAGAAAAACACACCACCACTG
ACATGGAAGATGCGTACCAGGATCATTGGGGAGATATGTTCAGCCTTGACCTTCATCCAC
TCACAGAAGCCTCACCCGGTTGTTCATGGTAATCTGAACCCCATGAACATTCTTCTTGAT
GCCAACTTTGTAAGCAAGTTGCACGTCTGCCAGCTTCTCAGAAAATACAACACCGGAAAT
AACACTTCAGGAACATCCTCCTACATTGACCCTGAATTCTTGTCCACCGGAGAACTCGCC
CCACGCTGCGACGTGTACTCCTTCGGCATTATCATCCTACATCTACTGACAGGAAAATCA
CCACAGAACATCACAACAATAGTAGAAGATGCTATGGAGAAAAGGCAGCTGCATTCAATC
ATGGACACCTCCGCAGGGAGCTGGCCCTTCGTGCAGGCCAACCAGCTTGCGCATCTCGGA
CTGAGATGCGCCAATTTGAGTGGAAGGCACCGGCCAGATCTCACGGGGGAGGTGTGGGGG
GTGATCAAGCCTCTGCTGAAGGATGCTTCCCAGAATTTTGGATGCAAACAAGCATTTGAA
GCTCTATCAGATGACACACAAGCACCATCCTACTTTATCTGCCCGATCTTGCAGGAGGTG
ATGACTGATCCTCACATCGCAGCAGACGGGTACACGTACGAAGCCAATGCCATCAGAAAC
TGGCTCGACGGCGGCAACGCCAGGTCGCCGATGACGAACCTGAGTCTCGAAAACCGCGAG
CTCACGCCGAACAGAGTGCTCCGCTCGGCTATCCTCGAGTGGCGACAGCACAGGAGATGA
CATCAACCTATTCCTCGATGCGGACTCAGCTCATCTAGATGCTTCATCTCACCTGTAAAA
TATAGTGGGGGATTTCTGGTGTTACCTGAACATGGCGTGTGCCTGTGCAGAAGTGTGCCT
CTAAAATCTCAATCACC

CDS

1665 bp

>Os02t0665800-01 UspA domain containing protein.
ATGGATAGCGACGGCGAAGAGTACGACGCGATGTGGAGCGCTCGGTGCAGCGTCAGCTCG
TCGGCCGGCTCTCTGCAGGACGCCGGCGACCAGTGGGACGAGCAGAGCCTGGCCGCCGGC
GAGGACAAGGTGTTCGTGGCCGTCGACGAGGACGTCGAGCACGGCAAGAGCACATTCCTT
TGGGCGCTGCAGAACCTGTCCACGGACGGGGCCAATATTGTAGTTGCTCATGTCCACAGC
CCTGCACAAACTCTCAGTAAAGTTCACTGTACCAGAATGAAGCCTGAAGAGATCAGCGAG
TACCTGATGTTGGCGAAGGAAGAGGCCGAGAAGAACCTAGATGAATATGCTCTGATAGCG
AAAAGCACAGGAAAAGATATGAAGACTGATTGTCAGAAAGTACTAATTGACATGGACGAT
GTCGCAAAAGGACTCGAGGAACTTATTACCCTTCATGGCATCACCAGGCTTGTCATGGGA
GCAGCCGCAGACCAACACTACTCAGAGGAAATGAAAGAACCAAATTCCAAGATAGCCCTC
AAGCTGATGGAGACTGCATCCCCATCATGCAAGATATGGTTTACCTGCAATGGCCATCTG
ATATGCACAAGGGAACCCAATGAAAACCTTCTTGCAATATATGTGCCGCCTGCACAAAGC
AACACGGTACCATTGTCAATGTGCAGCATTTCAAGCCAAATGAGTTCGATAGAGCTGAAG
AAAGAAGCACCAAGCTCAGAAGAATATACTTTAAGATCATTGGCTCAATCGGCAATGAGT
GATTGGGACTACATTTTCGGGGATTGGGGAAGGACAGGGTATGGTTCATTAAGGACTGAT
GATGCAATAAGTATTCCTGAAGCCACAACTCTAGCTGCGATTGTTGACGATACAAACAAA
CAAAGATCAGTGATGCACTCTCCTCAGGAATCTGACAGTGTCAATTTCTCATCACCAGCT
TGTGATCCCCAACAAGAAGAAGAAGAACCAAATTTAGATGAAGACATGCATGATATACTT
AATGAGGCATGCACTCGAGCTGAACTACTCAAGAAAGAAGTTGATGGTGAATCTAGCAAG
CGTCGCAAAGCTGAAATGGATCTACTTATAGCTCTTCAGAGAGTTCAAGAGTCAGAAAAA
TCATATCTACAGGAGGTGAACCAGCGGAAAGAAACTGAGAGGACACTTGCAAGACAGAGG
CTGGAGATCGATGAAATGAAAAGGCGACACAATACATTATATGATGAACTACAGGATACA
AAGAAACAGAAGCTTCTGCTGGAGCAACATATATCTGAGATTAAATCTGCTGCAAAAGAT
TATGTACAAGAGATTACTGAATATTTTATACAAGAATCATGTGAGGAAGCCAAGAAATTC
CAAAAGATCAAGATGGATCTGCTTGCGATGCTTCAAAGAGTTAAAGATGTGGAGAATTTA
AACCGAAATGAAAAGATGCAGAGGAAAGATATGGAGGAAAAGATTGCAAGACAGAGGATG
GAGATTGAAGAAACAAAAAGGCAGCGAGATGAATTATACCATGAGTTAAAAGATGTAAAG
GAACAGAAGCTCTGTCTGGAACGACTTGATTCATCTAAAGAAACTAAGAGGAGAAGAAAA
GCTGAGAGCGAGATGCTCTCCGCTCTTAAGAAGGTAAGATACTAA

Protein

555 aa

>Os02t0665800-01 UspA domain containing protein.
MDSDGEEYDAMWSARCSVSSSAGSLQDAGDQWDEQSLAAGEDKVFVAVDEDVEHGKSTFL
WALQNLSTDGANIVVAHVHSPAQTLSKVHCTRMKPEEISEYLMLAKEEAEKNLDEYALIA
KSTGKDMKTDCQKVLIDMDDVAKGLEELITLHGITRLVMGAAADQHYSEEMKEPNSKIAL
KLMETASPSCKIWFTCNGHLICTREPNENLLAIYVPPAQSNTVPLSMCSISSQMSSIELK
KEAPSSEEYTLRSLAQSAMSDWDYIFGDWGRTGYGSLRTDDAISIPEATTLAAIVDDTNK
QRSVMHSPQESDSVNFSSPACDPQQEEEEPNLDEDMHDILNEACTRAELLKKEVDGESSK
RRKAEMDLLIALQRVQESEKSYLQEVNQRKETERTLARQRLEIDEMKRRHNTLYDELQDT
KKQKLLLEQHISEIKSAAKDYVQEITEYFIQESCEEAKKFQKIKMDLLAMLQRVKDVENL
NRNEKMQRKDMEEKIARQRMEIEETKRQRDELYHELKDVKEQKLCLERLDSSKETKRRRK
AESEMLSALKKVRY*

5'UTR

chr02:27029085..27029183 (+ strand) : 99 bp

CDS

chr02:27029184..27029445 (+ strand) : 262 bp

chr02:27029526..27029647 (+ strand) : 122 bp

chr02:27029783..27029904 (+ strand) : 122 bp

chr02:27030291..27030395 (+ strand) : 105 bp

chr02:27030627..27030817 (+ strand) : 191 bp

chr02:27031596..27031762 (+ strand) : 167 bp

chr02:27031845..27031997 (+ strand) : 153 bp

chr02:27032161..27032457 (+ strand) : 297 bp

chr02:27032560..27032727 (+ strand) : 168 bp

chr02:27032805..27032882 (+ strand) : 78 bp

3'UTR

chr02:27032883..27033434 (+ strand) : 552 bp

chr02:27033538..27034275 (+ strand) : 738 bp

chr02:27034442..27034764 (+ strand) : 323 bp

FASTA

>Os02t0665800-01 class=Sequence position=chr02:27029085..27034764 (+ strand)
GTAACTTGAT CTCGAAATTT CCATTCATGA AACGGCTGGG CAGTTACTCT GCAGCTGCAT GGTCTTGTGC TTCTCATTTC
TCAACGTCAG GAAGCAGCAA TGGATAGCGA CGGCGAAGAG TACGACGCGA TGTGGAGCGC TCGGTGCAGC GTCAGCTCGT
CGGCCGGCTC TCTGCAGGAC GCCGGCGACC AGTGGGACGA GCAGAGCCTG GCCGCCGGCG AGGACAAGGT GTTCGTGGCC
GTCGACGAGG ACGTCGAGCA CGGCAAGAGC ACATTCCTTT GGGCGCTGCA GAACCTGTCC ACGGACGGGG CCAATATTGT
AGTTGCTCAT GTCCACAGCC CTGCACAAAC TCTCAGTAAA GGTAAGCATC TTGCTTCTCC TGCTTTGACA GCTACAATCA
CCTGGTGCAA TTCAGTTTAC ATTTCTCGAT GGGGACAAAA GTTCACTGTA CCAGAATGAA GCCTGAAGAG ATCAGCGAGT
ACCTGATGTT GGCGAAGGAA GAGGCCGAGA AGAACCTAGA TGAATATGCT CTGATAGCGA AAAGCACAGG AAAAGATATG
AAGGTAAAAT TGTCTCATTA CTTTTTTTGT TAGTGCTTGT GAAAAAAATT ACTTGCATCA AGTAACGTGG GGACGAAATG
ATGTTTATCA GTCAAAATAT AATCAATATG AGCATGAACA TTAATCCTAC TATTTCAGAC TGATTGTCAG AAAGTACTAA
TTGACATGGA CGATGTCGCA AAAGGACTCG AGGAACTTAT TACCCTTCAT GGCATCACCA GGCTTGTCAT GGGAGCAGCC
GCAGACCAAC ACTACTCAGA GTATGGACCA CATCTGCCTA ATGTAGCGTT TTTCCTGTAA TGTTTTCAAG AAAATTTTAC
TATTTCTCAT CGCAAATAAA AAAAAAGGGG AGAGAGATAG AGAGAGAAAT TTATTCCTGG AACTGGAGGC TCTGGTACTT
AAGACGGTGT ATCGGACTAT GTGGATAACT TAGTACTTGA AGCTCTGAAG ATTTATCAGG ACTAGGCTAT CAGCGTCAGC
AAATTAATGA ACTAAAACTT CAGTCGTAAA TTTATTTCAT TCTACACCAG CATCAGGAGT CCAGGACTAA TCAAACTACA
TAGGTAGCAG GAATAGATAG AACATTTTAT GAGATGAATC CATACTAAAT ATATGTGCAC AAACCTTATG ATATTATAAC
CTGTAGGGAA ATGAAAGAAC CAAATTCCAA GATAGCCCTC AAGCTGATGG AGACTGCATC CCCATCATGC AAGATATGGT
TTACCTGCAA TGGCCATCTG ATATGCACAA GGTAAAGTCA AGTGAATGGT CATTTGCTAC CTGACTTTTT GAACTTCATA
GAGCTTAGTG CATCTCATGC ATAATAGTAC TTCGTACAGC ATGCGGAGAA TTGTAGGACA CATAATGCTA CATTTGAGTA
TCTTTACTTC TGTCAACGAA TTGAACTAGG ATACCAGTGT ATTGCACTCT TACCAAGAAA CCAGGAAAAT GACTAAAATC
CATTAGTTGT GTGCACTTAC AGGGAACCCA ATGAAAACCT TCTTGCAATA TATGTGCCGC CTGCACAAAG CAACACGGTA
CCATTGTCAA TGTGCAGCAT TTCAAGCCAA ATGAGTTCGA TAGAGCTGAA GAAAGAAGCA CCAAGCTCAG AAGAATATAC
TTTAAGATCA TTGGCTCAAT CGGCAATGAG TGATTGGGAC TACATTTTCG GGGGTGACTA AACTGACTAT CCTAACATAT
TTAGAATTTC TAATTTACAC CCTTGCAAAA AAAAGGTTAT ATTGGATTTT CTTGCTTAAA TGATTTATGC ATACAGCATC
AAATTGTTGT TTTACATGAA TTCAAGGGGC CAAAAAATGA TATGTAGTTT CAATAGTTCT CCCAAAATAT AGTTTCAAGA
ATCCAGAGGT TTCAATAATT TATAGCTTAA ATTTAAtact ctctgcagtc atgaatattt gatgttgaag acaatattca
gtcaaactta taaaattccg accatcgata gtttctcaaa tggctagttt gaattctgaa aacaaaagaa atggtatgct
agaattcgcc ttgagaagaa ctatcataat atcataaact tattagattt tataaacttg ttataatata aattaatggt
cataatttta gaagtttaac cgatcttgcc ctaaacgtca aataTTCATG ACCAGAGGTA CTAGTATGTT TCTTCTTTGC
AAGCTATATT CCTGATCTGT GATGAAATTA CTGAAGCTTA CTACTAGGAT TTATACCTCA GAAGTCATAA CTTAAACAGT
AGGACATGTA GAAGCAGTGG GTCAAAATAA TCGTTTTTAG TTATTTAGAA CAACCGTGTT AATCATATAT CTGCAGAAAG
AAAAATGAAC TCCTACATGA GGAGAACAGA TGATTTGAGC CATGCTGTTG GCATTTCTCT TCTAAACGTA GTCATGCTAA
TCTCTATTTT ATTCATAATA ATGAACTCCA GATTGGGGAA GGACAGGGTA TGGTTCATTA AGGACTGATG ATGCAATAAG
TATTCCTGAA GCCACAACTC TAGCTGCGAT TGTTGACGAT ACAAACAAAC AAAGATCAGT GATGCACTCT CCTCAGGAAT
CTGACAGTGT CAATTTCTCA TCACCAGCTT GTGATCCCGT AAGACTACTA ATGCTAAATC ATTAAGTTAC CAAAGTAACT
AGCTGTAAGT AAATCTCTCT TAATGATTGG TGGCATGCAG CAACAAGAAG AAGAAGAACC AAATTTAGAT GAAGACATGC
ATGATATACT TAATGAGGCA TGCACTCGAG CTGAACTACT CAAGAAAGAA GTTGATGGTG AATCTAGCAA GCGTCGCAAA
GCTGAAATGG ATCTACTTAT AGCTCTTCAG AGAGTAAGCT TTGTTTTATT GGCTGACTCT GTAGCTTGTA TATTTGTAGA
GAAAAATAAA TAAAGTAACC CTCCTTTGGC CAGCGTACCA AATGTGACAT GCCTCCAAAA TACTGCTTAA ATTAATTTCT
CTTTTTAGGA CAAGTATAAC TAAATTAGTC TTACAGGTTC AAGAGTCAGA AAAATCATAT CTACAGGAGG TGAACCAGCG
GAAAGAAACT GAGAGGACAC TTGCAAGACA GAGGCTGGAG ATCGATGAAA TGAAAAGGCG ACACAATACA TTATATGATG
AACTACAGGA TACAAAGAAA CAGAAGCTTC TGCTGGAGCA ACATATATCT GAGATTAAAT CTGCTGCAAA AGATTATGTA
CAAGAGATTA CTGAATATTT TATACAAGAA TCATGTGAGG AAGCCAAGAA ATTCCAAAAG ATCAAGATGG ATCTGCTTGC
GATGCTTCAA AGAGTAAGCA CTTTGGTTCA GGACTCAGGA GCTTTTAATT TTTCCAAAAA AAAATTGACC AATTATCTAA
AAAATACGTG ACGAAAATCC AAACTATTAT TACAGGTTAA AGATGTGGAG AATTTAAACC GAAATGAAAA GATGCAGAGG
AAAGATATGG AGGAAAAGAT TGCAAGACAG AGGATGGAGA TTGAAGAAAC AAAAAGGCAG CGAGATGAAT TATACCATGA
GTTAAAAGAT GTAAAGGAAC AGAAGCTCTG TCTGGAACGA CTTGTAAGTA TGGCAGTATG ACTCAGATTC AGCATATTGG
TTTAATTCTT GCAGACGATC TTACTGAAAA CTTTATATAG GATTCATCTA AAGAAACTAA GAGGAGAAGA AAAGCTGAGA
GCGAGATGCT CTCCGCTCTT AAGAAGGTAA GATACTAAGA CGTTTGTTTC AGTGGTCTGT ACTCAGTACT ATGAATTGCA
GGTTTGTCAT GAAAATGTGG AGTACTCTTA CAGGTTCATG ACCTGGAGCA TCAGTATCTG AATGAGTTGA AAAGGCGGGA
AGCGGTGGAG GAGACATTTG CACGGCAAAA AGAGGAAATT CAAGAAACGA AAAGAGAGCT AAACAAGATA CGTAGCAGAC
ATATGACAGA GATCAAAGCT CATGAAGAAA AGCTTGCAGA AAGCATCCGC TTTATCCAAA AGATTCAAGC AAAGTATGAC
AAAACACTAC ATGAGAGAGA CACTGCCATA GCAGAATCTG AAAAATTGCG CCAAATGAAC AGGGATGGAG CTTCAATGAT
AGCAACCACC CAGATCGCCG ACTTCTCTTT TTTTGAGCTG CGGCAAGCAA CCCAAGACTT TGATACGGCA CTCAAGATTG
GCACAGGCAG ATTTATGAAT GTGTACAAAG GGTTCATACG GAACACGGCT ATAACTGTAA TGTTGCTTCA TCCTCAGGGC
CTGCAAGGGC AGTTAGAATT CCATCAAGAG GTAAATGAGA TAACTAAAGT TGAAGCTATA TAGCCATACA TTTCCCTTTC
AGCAGAAGAG CACTGAATCA TCATTTTCTG TATATGTGGC GTCATAACTG CAGGTTGTTG TTCTCAGTAG ACTGAGGCAT
CCTAACGTCA TGATGCTAAT AGGTGCATGT CCGGAAGCTT TTGGCATGGT GTATGAATTC CTCCCAAATG GGAGCCTCGA
GGACCAGCTC TCGTGCAAGA AAAACACACC ACCACTGACA TGGAAGATGC GTACCAGGAT CATTGGGGAG ATATGTTCAG
CCTTGACCTT CATCCACTCA CAGAAGCCTC ACCCGGTTGT TCATGGTAAT CTGAACCCCA TGAACATTCT TCTTGATGCC
AACTTTGTAA GCAAGTTGCA CGTCTGCCAG CTTCTCAGAA AATACAACAC CGGAAATAAC ACTTCAGGAA CATCCTCCTA
CATTGACCCT GAATTCTTGT CCACCGGAGA ACTCGCCCCA CGCTGCGACG TGTACTCCTT CGGCATTATC ATCCTACATC
TACTGACAGG AAAATCACCA CAGAACATCA CAACAATAGT AGAAGATGCT ATGGAGAAAA GGCAGCTGCA TTCAATCATG
GACACCTCCG CAGGGAGCTG GCCCTTCGTG CAGGCCAACC AGCTTGCGCA TCTCGGACTG AGATGCGCCA ATTTGAGTGG
AAGGCACCGG CCAGATCTCA CGGGGGAGGT GTGGGGGGTG ATCAAGCCTC TGCTGAAGGA TGCTTCCCAG AATTTTGGAT
GCAAACAAGC ATTTGAAGCT CTATCAGATG ACACACAAGC ACCATCCTAC TTTATCTGCC CGATCTTGCA GGTTGGTAAT
TTGCGACCAC ATGATAAATT GATGTGATAT AATTGATGAT TTCACACAAA ATTGACGGGG TTCTAGGTCG ATGTATTAGT
AGTGCTATAC TGGTTTATCC AATTGGGAGT ATGTATTCGA ACTTACCAGA ACTTTTGCTC CGATGGATGG TGAACAGGAG
GTGATGACTG ATCCTCACAT CGCAGCAGAC GGGTACACGT ACGAAGCCAA TGCCATCAGA AACTGGCTCG ACGGCGGCAA
CGCCAGGTCG CCGATGACGA ACCTGAGTCT CGAAAACCGC GAGCTCACGC CGAACAGAGT GCTCCGCTCG GCTATCCTCG
AGTGGCGACA GCACAGGAGA TGACATCAAC CTATTCCTCG ATGCGGACTC AGCTCATCTA GATGCTTCAT CTCACCTGTA
AAATATAGTG GGGGATTTCT GGTGTTACCT GAACATGGCG TGTGCCTGTG CAGAAGTGTG CCTCTAAAAT CTCAATCACC

Locus: Os02g0665800

Loading...

Locus: Os02g0665800

Loading...