Os02t0666200-01

Locus

Os02g0666200

Description

Aquaporin, Water channel, Salt tolerance, Seed germination, Response to osmotic and chilling stress

RAP-DB Gene Symbol Synonym(s)

OsPIP1;1, RWC1

RAP-DB Gene Name Synonym(s)

plasma membrane intrinsic protein 1;1

CGSNL Gene Symbol

PIP1A

CGSNL Gene Name

PLASMA MEMBRANE INTRINSIC PROTEIN 1A

Oryzabase Gene Symbol Synonym(s)

OsPIP1a, OsPIP1;1, PIP1a, RWC-1, PIP1-1, RWC1, OsPIP1-1, PIP1;1, PIP1-5

Oryzabase Gene Name Synonym(s)

Aquaporin PIP1-1, Plasma membrane intrinsic protein 1-1, Plasma membrane intrinsic protein 1a, Water channel protein RWC1, plasma membrane intrinsic protein 1-5

Transcript Evidence

AK103807

Protein Evidence

Q6EU94

Literature

PMID: 23262183

PMID: 20926385

Note

Manual Curation

December 18, 2020

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: channel activity (GO:0015267)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Aquaporin-like (IPR023271)

Major intrinsic protein (IPR000425)

Major intrinsic protein, conserved site (IPR022357)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

plasma membrane (GO:0005886) [co-expressed with OsPIP2;1]

Full-length cDNA

J033147A07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0666200-01)

RiceXPro (AK103807)

Others

Oryzabase (6255)

KEGG (Os02t0666200-01)

Transcript

1204 bp

>Os02t0666200-01 Aquaporin, Water channel, Salt tolerance, Seed germination, Response to osmotic and chilling stress
TTCTTCTTCAGTGTACTCTGCCTTTATAACACCCTACTCCTCTCTCTCACCTCCACCATC
TAGCTCACTCACACAGTCTCCACTCACACGCATTGCAGAGGAGAGGCGACAATGGAGGGG
AAGGAGGAGGACGTGCGGCTGGGGGCGAACAGGTACTCGGAGAGGCAGCCGATAGGGACG
GCGGCGCAGGGCGCCGGGGACGACAAGGACTACAAGGAGCCGCCGCCGGCGCCGCTGTTC
GAGCCAGGGGAGCTCAAGTCGTGGTCTTTCTACCGGGCCGGGATCGCCGAGTTCGTCGCC
ACCTTCCTCTTCCTCTACATCACCATCCTCACCGTCATGGGGGTCTCCAAGTCCTCCTCC
AAGTGCGCCACCGTCGGCATCCAGGGCATCGCCTGGTCCTTCGGAGGCATGATCTTCGCG
CTCGTCTACTGCACCGCCGGCATCTCCGGAGGACACATCAACCCAGCAGTTACTTTTGGG
CTGTTCTTGGCCAGGAAGCTGTCCCTGACCCGGGCCATCTTCTACATAGTGATGCAATGC
CTAGGGGCCATCTGCGGAGCTGGAGTTGTGAAGGGCTTCCAGCAGGGTCTGTACATGGGC
AATGGCGGTGGTGCCAATGTAGTTGCCAGTGGCTACACCAAGGGTGACGGTCTTGGTGCT
GAGATTGTTGGCACCTTCATCCTGGTCTACACCGTCTTCTCAGCCACTGATGCCAAGAGG
AATGCCAGGGACTCACATGTTCCTATCCTTGCCCCACTGCCAATTGGTTTTGCGGTGTTC
CTGGTCCACCTGGCCACCATCCCCATCACCGGTACTGGCATCAACCCAGCCAGGAGCCTT
GGCGCTGCCATCATCTACAACAAGGACCATGCCTGGAATGACCATTGGATCTTCTGGGTT
GGTCCCTTCGTTGGCGCTGCCCTGGCTGCCATCTACCACCAGGTGATCATCAGGGCGATC
CCATTCAAGAGCAGGTCTTAAGCCCCGCGCCGCCGCTGCGCAGCCGACGACATGCAACGC
AATCGTGATGTCCTGTTTCCCGCGCGCTACTGCTGCGCATCTGTCGATTCCCTCTATCTC
TAGTCCCCAAGATGTTTTTCCTATCTGAACCCTGAACAACTCAATCGTGTAATCCAGTAC
TCAGTCACTGTATGTTTTTATGTGATGGAGATCTTAATTCTTAAGTTATCATCTCTGTTG
CTGG

CDS

870 bp

>Os02t0666200-01 Aquaporin, Water channel, Salt tolerance, Seed germination, Response to osmotic and chilling stress
ATGGAGGGGAAGGAGGAGGACGTGCGGCTGGGGGCGAACAGGTACTCGGAGAGGCAGCCG
ATAGGGACGGCGGCGCAGGGCGCCGGGGACGACAAGGACTACAAGGAGCCGCCGCCGGCG
CCGCTGTTCGAGCCAGGGGAGCTCAAGTCGTGGTCTTTCTACCGGGCCGGGATCGCCGAG
TTCGTCGCCACCTTCCTCTTCCTCTACATCACCATCCTCACCGTCATGGGGGTCTCCAAG
TCCTCCTCCAAGTGCGCCACCGTCGGCATCCAGGGCATCGCCTGGTCCTTCGGAGGCATG
ATCTTCGCGCTCGTCTACTGCACCGCCGGCATCTCCGGAGGACACATCAACCCAGCAGTT
ACTTTTGGGCTGTTCTTGGCCAGGAAGCTGTCCCTGACCCGGGCCATCTTCTACATAGTG
ATGCAATGCCTAGGGGCCATCTGCGGAGCTGGAGTTGTGAAGGGCTTCCAGCAGGGTCTG
TACATGGGCAATGGCGGTGGTGCCAATGTAGTTGCCAGTGGCTACACCAAGGGTGACGGT
CTTGGTGCTGAGATTGTTGGCACCTTCATCCTGGTCTACACCGTCTTCTCAGCCACTGAT
GCCAAGAGGAATGCCAGGGACTCACATGTTCCTATCCTTGCCCCACTGCCAATTGGTTTT
GCGGTGTTCCTGGTCCACCTGGCCACCATCCCCATCACCGGTACTGGCATCAACCCAGCC
AGGAGCCTTGGCGCTGCCATCATCTACAACAAGGACCATGCCTGGAATGACCATTGGATC
TTCTGGGTTGGTCCCTTCGTTGGCGCTGCCCTGGCTGCCATCTACCACCAGGTGATCATC
AGGGCGATCCCATTCAAGAGCAGGTCTTAA

Protein

289 aa

>Os02t0666200-01 Aquaporin, Water channel, Salt tolerance, Seed germination, Response to osmotic and chilling stress
MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE
FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV
TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG
LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA
RSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKSRS*

5'UTR

chr02:27044341..27044451 (+ strand) : 111 bp

CDS

chr02:27044452..27044788 (+ strand) : 337 bp

chr02:27045780..27046075 (+ strand) : 296 bp

chr02:27046435..27046575 (+ strand) : 141 bp

chr02:27047063..27047158 (+ strand) : 96 bp

3'UTR

chr02:27047159..27047381 (+ strand) : 223 bp

FASTA

>Os02t0666200-01 class=Sequence position=chr02:27044341..27047381 (+ strand)
TTCTTCTTCA GTGTACTCTG CCTTTATAAC ACCCTACTCC TCTCTCTCAC CTCCACCATC TAGCTCACTC ACACAGTCTC
CACTCACACG CATTGCAGAG GAGAGGCGAC AATGGAGGGG AAGGAGGAGG ACGTGCGGCT GGGGGCGAAC AGGTACTCGG
AGAGGCAGCC GATAGGGACG GCGGCGCAGG GCGCCGGGGA CGACAAGGAC TACAAGGAGC CGCCGCCGGC GCCGCTGTTC
GAGCCAGGGG AGCTCAAGTC GTGGTCTTTC TACCGGGCCG GGATCGCCGA GTTCGTCGCC ACCTTCCTCT TCCTCTACAT
CACCATCCTC ACCGTCATGG GGGTCTCCAA GTCCTCCTCC AAGTGCGCCA CCGTCGGCAT CCAGGGCATC GCCTGGTCCT
TCGGAGGCAT GATCTTCGCG CTCGTCTACT GCACCGCCGG CATCTCCGGT CAGTTCACTC TCCTTTGGCT TCCTCCCCCA
CCTTCAAGAT CTCAAGTCTT CAACTTTGTC ATGATTTTGC CTTGGTTTGT CTTGCTAGTT GATACTTACT TGTTACCTGC
ACTTTGCTTG GCTCAGTAGT TTCTTCATAC TAGCATGCTC ACTTTAGTAA AGCATGAGGT ATAGAATCAT GTGTACTACT
ACTGCTCCTT CCATAAGTAG CAAGACTTTG AGGCATATGG CATTAACACT GAATAATTGA TGAAAGACTT TTAGTTACCT
GCTTTTGGGG TGTTAGATCA GTATTAGTAA CTGGAAATTC ACTAAATTTG TTGTCCATGC TCTTGTAGTT TTAAAGAATT
ATTATAGCTT TCTACAGGTG TTGAATGCAC CAAAAATTTA TGACACTACC TTTTGCTCTT GTACCATCAT GTACCTTGTC
TGCGCAAAGA TTTGTCGCTG GCATATTGTA CTGCTGTGGT ATGTGAATTT TGTTCTTATG CAAAGGTTTG ATTTACGACT
AGAAGATTAA GGATTTAAGG TCATCCGATT GATTTAACTC TTAACCCAGC ATTTTCTTCG GTAGTGTTCT AACTGTTGAT
GCTGAAACCA CACAAATTAT CACACAAAAA TATATTATTT TTAGTTCATC AAAATTGAAT GTGCACTTGG AGCCTTGGAG
GCAAAGAAAT ATGTGATGCC AAAATTTTCT CCTTGGTTAA TCTTCCTACC AGAATATTAA CAAAACTATA TGAACAAGTA
AATATCTTGT GTTGTCAACT TATACAGTCT ATCACAACTC GCAATCTTAG AAGTTAATTT CTGTACCAGT TTTATATAAT
GCTTCAAAAT CTCAAATACT ACCTTGTTAA TCTCAAAATA TGAATACATG AGGGTACACT ATACAGTCTT ACTTCAACTG
TCATGACAAC TGACCACAAA ACAACTACGG CAATTAAGGG CACTACTAAT ATCCATTATA TTGTCTGTTA CTGCAACAGG
AGGACACATC AACCCAGCAG TTACTTTTGG GCTGTTCTTG GCCAGGAAGC TGTCCCTGAC CCGGGCCATC TTCTACATAG
TGATGCAATG CCTAGGGGCC ATCTGCGGAG CTGGAGTTGT GAAGGGCTTC CAGCAGGGTC TGTACATGGG CAATGGCGGT
GGTGCCAATG TAGTTGCCAG TGGCTACACC AAGGGTGACG GTCTTGGTGC TGAGATTGTT GGCACCTTCA TCCTGGTCTA
CACCGTCTTC TCAGCCACTG ATGCCAAGAG GAATGCCAGG GACTCACATG TTCCTGTAAG TATCCTTCTC CTTTTTGCAG
TGTGATATGT GAAAGTTCAG TAGTAGTTAG TGTGGTCTAA TGAGTTATGC ACTGTGATAA CTAATTCATC ACCAAACCCT
AAAGTGATAA TGTGCAAATC ACTAAGCAGT ATTTTGGTTA GCACCTTTAC ATACCTCACT CATACAGTAT GCCTTTAACA
ATGAACTGGT GTGCTCATAA CTTGTAGGTG TGCGCCATTT ATGGCTAGAC TTTTAACTAG TTTAATTTAT CATGTTTGCT
CAAGAAATTG ACTGTATGCG TATAGTTACT GGAAGTATAT ATGGGTTTTT TGTGTGTTGC ATAACGTATT TCTGTCCTTT
GTTGGTGAAA ACAGATCCTT GCCCCACTGC CAATTGGTTT TGCGGTGTTC CTGGTCCACC TGGCCACCAT CCCCATCACC
GGTACTGGCA TCAACCCAGC CAGGAGCCTT GGCGCTGCCA TCATCTACAA CAAGGACCAT GCCTGGAATG ACCATGTGAG
CAACCTTTCT TCTCTTTTTA CCTACTCGCC GTTCTCAGCA ATTGGTTCCT CTTACATTAT CAGATATTAG TCAGCACATC
ATTGATAATC GATACATTTT TTGTTGGCAA ATTGAGGTCT AAGCTGATAA ACATGTCAGT ATATATAATC AAATGTTCTC
AGCAATTGGT TCCTCTTACA TTATCAGATA TTAGTCAGCA CATTACTGAT AATCGATACA TTTTTTGTTG GCAAATTGAG
GTCTAAGCTG ATAAACATGT CAGTATATAT AATCAAATGT TCTGATACTT TTTTTGGTTA TATTTTTCTC TTTGTATGGG
TAGGTCTAAG ATGATAAACA TGTCACTATA ACCAAATGTA GCAGCATGCT CTTGCTAAAG TTTACTTAGT AGCTTACCAG
CTTACTAGCC TTTGCTCAAG AAAAGAGTAG AAGACACGAC AAAGAGTTTT TCCTTACAAA TTTTGGTATC TAAATTTTGC
AGTGGATCTT CTGGGTTGGT CCCTTCGTTG GCGCTGCCCT GGCTGCCATC TACCACCAGG TGATCATCAG GGCGATCCCA
TTCAAGAGCA GGTCTTAAGC CCCGCGCCGC CGCTGCGCAG CCGACGACAT GCAACGCAAT CGTGATGTCC TGTTTCCCGC
GCGCTACTGC TGCGCATCTG TCGATTCCCT CTATCTCTAG TCCCCAAGAT GTTTTTCCTA TCTGAACCCT GAACAACTCA
ATCGTGTAAT CCAGTACTCA GTCACTGTAT GTTTTTATGT GATGGAGATC TTAATTCTTA AGTTATCATC TCTGTTGCTG
G

Locus: Os02g0666200

Loading...

Locus: Os02g0666200

Loading...