Os02t0666200-02

Locus

Os02g0666200

Description

Aquaporin.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PIP1A

CGSNL Gene Name

PLASMA MEMBRANE INTRINSIC PROTEIN 1A

Oryzabase Gene Symbol Synonym(s)

OsPIP1a, OsPIP1;1, PIP1a, RWC-1, PIP1-1, RWC1, OsPIP1-1, PIP1;1, PIP1-5

Oryzabase Gene Name Synonym(s)

Aquaporin PIP1-1, Plasma membrane intrinsic protein 1-1, Plasma membrane intrinsic protein 1a, Water channel protein RWC1, plasma membrane intrinsic protein 1-5

Transcript Evidence

AK061769 (DDBJ, Best hit)

AK104658 (DDBJ, Best hit)

Protein Evidence

B7SDI4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: water transport (GO:0006833)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Major intrinsic protein (IPR000425)

Aquaporin (IPR012269)

Major intrinsic protein, conserved site (IPR022357)

Aquaporin-like (IPR023271)

Full-length cDNA

001-039-C05 (Online Clone Ordering)

006-311-D06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0666200-02)

Others

Oryzabase (6255)

Transcript

1136 bp

>Os02t0666200-02 Aquaporin.
ACCATCTAGCTCACTCACACAGTCTCCACTCACACGCATTGCAGAGGAGAGGCGACAATG
GAGGGGAAGGAGGAGGACGTGCGGCTGGGGGCGAACAGGTACTCGGAGAGGCAGCCGATA
GGGACGGCGGCGCAGGGCGCCGGGGACGACAAGGACTACAAGGAGCCGCCGCCGGCGCCG
CTGTTCGAGCCAGGGGAGCTCAAGTCGTGGTCTTTCTACCGGGCCGGGATCGCCGAGTTC
GTCGCCACCTTCCTCTTCCTCTACATCACCATCCTCACCGTCATGGGGGTCTCCAAGTCC
TCCTCCAAGTGCGCCACCGTCGGCATCCAGGGCATCGCCTGGTCCTTCGGAGGCATGATC
TTCGCGCTCGTCTACTGCACCGCCGGCATCTCCGGAGGACACATCAACCCAGCAGTTACT
TTTGGGCTGTTCTTGGCCAGGAAGCTGTCCCTGACCCGGGCCATCTTCTACATAGTGATG
CAATGCCTAGGGGCCATCTGCGGAGCTGGAGTTGTGAAGGGCTTCCAGCAGGGTCTGTAC
ATGGGCAATGGCGGTGGTGCCAATGTAGTTGCCAGTGGCTACACCAAGGGTGACGGTCTT
GGTGCTGAGATTGTTGGCACCTTCATCCTGGTCTACACCGTCTTCTCAGCCACTGATGCC
AAGAGGAATGCCAGGGACTCACATGTTCCTATCCTTGCCCCACTGCCAATTGGTTTTGCG
GTGTTCCTGGTCCACCTGGCCACCATCCCCATCACCGGTACTGGCATCAACCCAGCCAGG
AGCCTTGGCGCTGCCATCATCTACAACAAGGACCATGCCTGGAATGACCATTGGATCTTC
TGGGTTGGTCCCTTCGTTGGCGCTGCCCTGGCTGCCATCTACCACCAGGTGATCATCAGG
GCGATCCCATTCAAGAGCAGGTCTTAAGCCCCGCGCCGCCGCTGCGCAGCCGACGACATG
CAACGCAATCGTGATGTCCTGTTTCCCGCGCGCTACTGCTGCGCATCTGTCGATTCCCTC
TATCTCTAGTCCCCAAGATGTTTTTCCTATCTGAACCCTGAACAACTCAATCGTGTAATC
CAGTACTCAGTCACTGTATGTTTTTATGTGATGGAGATCTTAATTCTTAAGTTATC

CDS

870 bp

>Os02t0666200-02 Aquaporin.
ATGGAGGGGAAGGAGGAGGACGTGCGGCTGGGGGCGAACAGGTACTCGGAGAGGCAGCCG
ATAGGGACGGCGGCGCAGGGCGCCGGGGACGACAAGGACTACAAGGAGCCGCCGCCGGCG
CCGCTGTTCGAGCCAGGGGAGCTCAAGTCGTGGTCTTTCTACCGGGCCGGGATCGCCGAG
TTCGTCGCCACCTTCCTCTTCCTCTACATCACCATCCTCACCGTCATGGGGGTCTCCAAG
TCCTCCTCCAAGTGCGCCACCGTCGGCATCCAGGGCATCGCCTGGTCCTTCGGAGGCATG
ATCTTCGCGCTCGTCTACTGCACCGCCGGCATCTCCGGAGGACACATCAACCCAGCAGTT
ACTTTTGGGCTGTTCTTGGCCAGGAAGCTGTCCCTGACCCGGGCCATCTTCTACATAGTG
ATGCAATGCCTAGGGGCCATCTGCGGAGCTGGAGTTGTGAAGGGCTTCCAGCAGGGTCTG
TACATGGGCAATGGCGGTGGTGCCAATGTAGTTGCCAGTGGCTACACCAAGGGTGACGGT
CTTGGTGCTGAGATTGTTGGCACCTTCATCCTGGTCTACACCGTCTTCTCAGCCACTGAT
GCCAAGAGGAATGCCAGGGACTCACATGTTCCTATCCTTGCCCCACTGCCAATTGGTTTT
GCGGTGTTCCTGGTCCACCTGGCCACCATCCCCATCACCGGTACTGGCATCAACCCAGCC
AGGAGCCTTGGCGCTGCCATCATCTACAACAAGGACCATGCCTGGAATGACCATTGGATC
TTCTGGGTTGGTCCCTTCGTTGGCGCTGCCCTGGCTGCCATCTACCACCAGGTGATCATC
AGGGCGATCCCATTCAAGAGCAGGTCTTAA

Protein

289 aa

>Os02t0666200-02 Aquaporin.
MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE
FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV
TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG
LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA
RSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKSRS*

5'UTR

chr02:27044395..27044451 (+ strand) : 57 bp

CDS

chr02:27044452..27044788 (+ strand) : 337 bp

chr02:27045780..27046075 (+ strand) : 296 bp

chr02:27046435..27046575 (+ strand) : 141 bp

chr02:27047063..27047158 (+ strand) : 96 bp

3'UTR

chr02:27047159..27047367 (+ strand) : 209 bp

FASTA

>Os02t0666200-02 class=Sequence position=chr02:27044395..27047367 (+ strand)
ACCATCTAGC TCACTCACAC AGTCTCCACT CACACGCATT GCAGAGGAGA GGCGACAATG GAGGGGAAGG AGGAGGACGT
GCGGCTGGGG GCGAACAGGT ACTCGGAGAG GCAGCCGATA GGGACGGCGG CGCAGGGCGC CGGGGACGAC AAGGACTACA
AGGAGCCGCC GCCGGCGCCG CTGTTCGAGC CAGGGGAGCT CAAGTCGTGG TCTTTCTACC GGGCCGGGAT CGCCGAGTTC
GTCGCCACCT TCCTCTTCCT CTACATCACC ATCCTCACCG TCATGGGGGT CTCCAAGTCC TCCTCCAAGT GCGCCACCGT
CGGCATCCAG GGCATCGCCT GGTCCTTCGG AGGCATGATC TTCGCGCTCG TCTACTGCAC CGCCGGCATC TCCGGTCAGT
TCACTCTCCT TTGGCTTCCT CCCCCACCTT CAAGATCTCA AGTCTTCAAC TTTGTCATGA TTTTGCCTTG GTTTGTCTTG
CTAGTTGATA CTTACTTGTT ACCTGCACTT TGCTTGGCTC AGTAGTTTCT TCATACTAGC ATGCTCACTT TAGTAAAGCA
TGAGGTATAG AATCATGTGT ACTACTACTG CTCCTTCCAT AAGTAGCAAG ACTTTGAGGC ATATGGCATT AACACTGAAT
AATTGATGAA AGACTTTTAG TTACCTGCTT TTGGGGTGTT AGATCAGTAT TAGTAACTGG AAATTCACTA AATTTGTTGT
CCATGCTCTT GTAGTTTTAA AGAATTATTA TAGCTTTCTA CAGGTGTTGA ATGCACCAAA AATTTATGAC ACTACCTTTT
GCTCTTGTAC CATCATGTAC CTTGTCTGCG CAAAGATTTG TCGCTGGCAT ATTGTACTGC TGTGGTATGT GAATTTTGTT
CTTATGCAAA GGTTTGATTT ACGACTAGAA GATTAAGGAT TTAAGGTCAT CCGATTGATT TAACTCTTAA CCCAGCATTT
TCTTCGGTAG TGTTCTAACT GTTGATGCTG AAACCACACA AATTATCACA CAAAAATATA TTATTTTTAG TTCATCAAAA
TTGAATGTGC ACTTGGAGCC TTGGAGGCAA AGAAATATGT GATGCCAAAA TTTTCTCCTT GGTTAATCTT CCTACCAGAA
TATTAACAAA ACTATATGAA CAAGTAAATA TCTTGTGTTG TCAACTTATA CAGTCTATCA CAACTCGCAA TCTTAGAAGT
TAATTTCTGT ACCAGTTTTA TATAATGCTT CAAAATCTCA AATACTACCT TGTTAATCTC AAAATATGAA TACATGAGGG
TACACTATAC AGTCTTACTT CAACTGTCAT GACAACTGAC CACAAAACAA CTACGGCAAT TAAGGGCACT ACTAATATCC
ATTATATTGT CTGTTACTGC AACAGGAGGA CACATCAACC CAGCAGTTAC TTTTGGGCTG TTCTTGGCCA GGAAGCTGTC
CCTGACCCGG GCCATCTTCT ACATAGTGAT GCAATGCCTA GGGGCCATCT GCGGAGCTGG AGTTGTGAAG GGCTTCCAGC
AGGGTCTGTA CATGGGCAAT GGCGGTGGTG CCAATGTAGT TGCCAGTGGC TACACCAAGG GTGACGGTCT TGGTGCTGAG
ATTGTTGGCA CCTTCATCCT GGTCTACACC GTCTTCTCAG CCACTGATGC CAAGAGGAAT GCCAGGGACT CACATGTTCC
TGTAAGTATC CTTCTCCTTT TTGCAGTGTG ATATGTGAAA GTTCAGTAGT AGTTAGTGTG GTCTAATGAG TTATGCACTG
TGATAACTAA TTCATCACCA AACCCTAAAG TGATAATGTG CAAATCACTA AGCAGTATTT TGGTTAGCAC CTTTACATAC
CTCACTCATA CAGTATGCCT TTAACAATGA ACTGGTGTGC TCATAACTTG TAGGTGTGCG CCATTTATGG CTAGACTTTT
AACTAGTTTA ATTTATCATG TTTGCTCAAG AAATTGACTG TATGCGTATA GTTACTGGAA GTATATATGG GTTTTTTGTG
TGTTGCATAA CGTATTTCTG TCCTTTGTTG GTGAAAACAG ATCCTTGCCC CACTGCCAAT TGGTTTTGCG GTGTTCCTGG
TCCACCTGGC CACCATCCCC ATCACCGGTA CTGGCATCAA CCCAGCCAGG AGCCTTGGCG CTGCCATCAT CTACAACAAG
GACCATGCCT GGAATGACCA TGTGAGCAAC CTTTCTTCTC TTTTTACCTA CTCGCCGTTC TCAGCAATTG GTTCCTCTTA
CATTATCAGA TATTAGTCAG CACATCATTG ATAATCGATA CATTTTTTGT TGGCAAATTG AGGTCTAAGC TGATAAACAT
GTCAGTATAT ATAATCAAAT GTTCTCAGCA ATTGGTTCCT CTTACATTAT CAGATATTAG TCAGCACATT ACTGATAATC
GATACATTTT TTGTTGGCAA ATTGAGGTCT AAGCTGATAA ACATGTCAGT ATATATAATC AAATGTTCTG ATACTTTTTT
TGGTTATATT TTTCTCTTTG TATGGGTAGG TCTAAGATGA TAAACATGTC ACTATAACCA AATGTAGCAG CATGCTCTTG
CTAAAGTTTA CTTAGTAGCT TACCAGCTTA CTAGCCTTTG CTCAAGAAAA GAGTAGAAGA CACGACAAAG AGTTTTTCCT
TACAAATTTT GGTATCTAAA TTTTGCAGTG GATCTTCTGG GTTGGTCCCT TCGTTGGCGC TGCCCTGGCT GCCATCTACC
ACCAGGTGAT CATCAGGGCG ATCCCATTCA AGAGCAGGTC TTAAGCCCCG CGCCGCCGCT GCGCAGCCGA CGACATGCAA
CGCAATCGTG ATGTCCTGTT TCCCGCGCGC TACTGCTGCG CATCTGTCGA TTCCCTCTAT CTCTAGTCCC CAAGATGTTT
TTCCTATCTG AACCCTGAAC AACTCAATCG TGTAATCCAG TACTCAGTCA CTGTATGTTT TTATGTGATG GAGATCTTAA
TTCTTAAGTT ATC

Locus: Os02g0666200

Loading...

Locus: Os02g0666200

Loading...