Os02t0676500-00

Locus

Os02g0676500

Description

Similar to OSIGBa0127A14.6 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-2

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-2, RING-H2 protein 2

Transcript Evidence

CT835321 (DDBJ, Best hit)

Protein Evidence

Q01JM1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-H2-type (IPR024766)

Expression Databases

TENOR (Os02t0676500-00)

Others

Oryzabase (11763)

KEGG (Os02t0676500-00)

Transcript

1257 bp

>Os02t0676500-00 Similar to OSIGBa0127A14.6 protein.
CATTCGTTGCCAGCGCCCCACGCAAATCCCAAATCCCAAACCCCGCGGCGATGGCCACCG
TCGCCCAGCCCGACCCCAGCAGCAGCAGCCGCCGCACCGCCGCTCTTATACGCCGCAGCG
GCAGCGTCCTGCTCGAGCAACCGTATTATTAGCCACGGCCCCGCACGCCCGCTTGATCCG
CCTGCTGCGCGCGCGCGAGTTTTTTTTTTTTCCTTTTTTCCTGTTGGTGTTGCGCGGTGG
GCGAGAGGTGTTGGGGGGAAGATGCTGGGGTCGGGGCTGAATCTGGTGACCACGGTGATC
GGCTTCGGGATGAGTGCCACCTTCATCGTCTTCGTCTGCGCGCGCCTCATCTGCGGCCGC
GCCGCGCGGGCCGACGCCGAGGCCGACGCCGCCGAGGGCAGGGTCGCGGCCGCGCGGGCC
ATGGCGGCTGGCCCCGCGCCGTTCGACTTCGACGTCGAGTTCCGGGCCACGGATCTCGAC
CGCACGATTGAGCATACCCGTAGTGGATTGGAACCTTTTGTTGTTGCTGCAATTCCTACA
ATGAAGTACAGCTACGAGGCCTTCCAATCAAAAGATGATGCCCAGTGCTCCATATGTTTA
GGTGAATACAATGAGAAAGAGATTCTGCGCATCATGCCCAAATGCCGTCATAATTTTCAT
CTTTCCTGTATAGATGTATGGTTACAAAAGCAAACTACTTGTCCGATATGCCGGATCTCA
TTGAAGGACCTACCCAGTGGAAAACCTGCCGAGTCCCCTGTCCGTAGTCTCCCTCAACTA
TTCAGCCACCCTGAAAGCTCAGTGAGTCGATCACCTCATTGGATACTTCCTATCCATCGT
GATCGTACTGGAGGTAGAGAAAGCAGCCCGGCTTCACAAGAAACAGTAGAGGTGGTCATT
GAAATCCAACAAGAAATGCACTGAGGACATGGATGTATAGAGGCGAGATATCGATAGAAG
TTGATGAAACTATTTTGTTTTTCGGTTGAGCAACAAAGATATCTTCTATTGCAGAAACGC
CGTGCGTTCTTCCAGCAGCAGGGCAGCACGTACACGGCTTTGGCACAGAATTGCAAGGAA
TTTGTTTACGACAGGACTGGATTTTAGGCATTCTTTGTACATTTGAGGGTGTAGATTAGC
GGGTTGCCTTTTGCCCCTCTGTTCATTTTTTATGTGTCCTTGATGTATAGTGTAAAAGGA
AGCATTAACAATACTGATCAGATTCGGGGCCGCGAAAATATTTGTAGCAGCGCCGTT

CDS

663 bp

>Os02t0676500-00 Similar to OSIGBa0127A14.6 protein.
ATGCTGGGGTCGGGGCTGAATCTGGTGACCACGGTGATCGGCTTCGGGATGAGTGCCACC
TTCATCGTCTTCGTCTGCGCGCGCCTCATCTGCGGCCGCGCCGCGCGGGCCGACGCCGAG
GCCGACGCCGCCGAGGGCAGGGTCGCGGCCGCGCGGGCCATGGCGGCTGGCCCCGCGCCG
TTCGACTTCGACGTCGAGTTCCGGGCCACGGATCTCGACCGCACGATTGAGCATACCCGT
AGTGGATTGGAACCTTTTGTTGTTGCTGCAATTCCTACAATGAAGTACAGCTACGAGGCC
TTCCAATCAAAAGATGATGCCCAGTGCTCCATATGTTTAGGTGAATACAATGAGAAAGAG
ATTCTGCGCATCATGCCCAAATGCCGTCATAATTTTCATCTTTCCTGTATAGATGTATGG
TTACAAAAGCAAACTACTTGTCCGATATGCCGGATCTCATTGAAGGACCTACCCAGTGGA
AAACCTGCCGAGTCCCCTGTCCGTAGTCTCCCTCAACTATTCAGCCACCCTGAAAGCTCA
GTGAGTCGATCACCTCATTGGATACTTCCTATCCATCGTGATCGTACTGGAGGTAGAGAA
AGCAGCCCGGCTTCACAAGAAACAGTAGAGGTGGTCATTGAAATCCAACAAGAAATGCAC
TGA

Protein

221 aa

>Os02t0676500-00 Similar to OSIGBa0127A14.6 protein.
MLGSGLNLVTTVIGFGMSATFIVFVCARLICGRAARADAEADAAEGRVAAARAMAAGPAP
FDFDVEFRATDLDRTIEHTRSGLEPFVVAAIPTMKYSYEAFQSKDDAQCSICLGEYNEKE
ILRIMPKCRHNFHLSCIDVWLQKQTTCPICRISLKDLPSGKPAESPVRSLPQLFSHPESS
VSRSPHWILPIHRDRTGGRESSPASQETVEVVIEIQQEMH*

5'UTR

chr02:27602322..27602582 (+ strand) : 261 bp

CDS

chr02:27602583..27602807 (+ strand) : 225 bp

chr02:27604896..27604993 (+ strand) : 98 bp

chr02:27606107..27606446 (+ strand) : 340 bp

3'UTR

chr02:27606447..27606779 (+ strand) : 333 bp

FASTA

>Os02t0676500-00 class=Sequence position=chr02:27602322..27606779 (+ strand)
CATTCGTTGC CAGCGCCCCA CGCAAATCCC AAATCCCAAA CCCCGCGGCG ATGGCCACCG TCGCCCAGCC CGACCCCAGC
AGCAGCAGCC GCCGCACCGC CGCTCTTATA CGCCGCAGCG GCAGCGTCCT GCTCGAGCAA CCGTATTATT AGCCACGGCC
CCGCACGCCC GCTTGATCCG CCTGCTGCGC GCGCGCGAGT TTTTTTTTTT TCCTTTTTTC CTGTTGGTGT TGCGCGGTGG
GCGAGAGGTG TTGGGGGGAA GATGCTGGGG TCGGGGCTGA ATCTGGTGAC CACGGTGATC GGCTTCGGGA TGAGTGCCAC
CTTCATCGTC TTCGTCTGCG CGCGCCTCAT CTGCGGCCGC GCCGCGCGGG CCGACGCCGA GGCCGACGCC GCCGAGGGCA
GGGTCGCGGC CGCGCGGGCC ATGGCGGCTG GCCCCGCGCC GTTCGACTTC GACGTCGAGT TCCGGGCCAC GGATCTCGAC
CGCACGGTAA GATTTCTGTG CTCTACTCCG GTAATAACAT CATCTAGCGT TTAGCTGGTT GGCGTGGGAT GGCTCTGTGC
GCATTGCTGC GTGGTGAATT GTTGATGCTG TGCCGCTTGA ATTGCTTTTT AACATGACTC CATAAGCGAT GGGTCCAATA
GTTCGCAATT TCTACGGGTA TGGCAACCAG TTCACGGAAA TGACAAATCG CCACGCCTCA CACTGATTTA ATTTGTTCCA
GCAGTGGAAA ATCTAAAAAA AAAAACGAAT GGTTCCTCCA TTTACTTCCA ATTATCTGGA TACAAATTAG ACAACAATTC
AAGGCTTCAA GCTTGTTTAT GAATGGCTCC TTCATTTGAT TTCAGTTATA ACCAGGGTTT AATCTTTCGG TTTGGACGTT
TCTATCAGAG GGTGCTGATA TACTGAAATT GCAGAAATTT CGTTCTGAaa ttttgaagac attttagtca aagttgaata
aaataattcc aaattcacaa aaaaaaattc ggccaaaata atatcattgg gggggggggt ccgatatgat cgaaatttcg
ttccggaatt ttgaaccctg gatataCCTG GATACAAATT AGACAACAAT TCAATGCTTC AAACTTGTTT AGTTGTGCAT
GACGTGCAAA TTCTGTTATA TAGCAATTGA GCAATAAATG CACATCACAC TTTAACTCAG GATTGATGCA TACTATTTGC
AATGCAAGCT ATTCTTTCTA ACAGAAAGAT AGATGGGCAT TGCCTTTTTA AAACCTAACT AAGCTTCAAA TGTGGAAAAA
ATGCTTGCTC CAAATGCGTC TGAAAAATCC TAGTAACAAT GAGGTGATAA AATGGAGAAG GAAATTATGT GTCTGAATTG
AGCAAGGAGT GATAACTTGG GAACCAAAAG TACTACTAAT CCTACTAATA AAAACTATTA ACTTGAGTAA ACATCGTAAT
AAAAAAGATT TTGTAGTTAT ATTAAAAAGA GAGAGAGAAG ACATGGTCTT GTTCCAAAAT AAATGCAGTT CGTGTTGGCC
ATATAGTTAT GCCAAAGATT TCCTTTGCTA ATCAAACCAG CCATAGAAAT TTCAAGTTAC TTAACATAAT GTAAACTTGT
TTTTTCTTCT GATGTATGTC TAATGCTTGG TCACAATATA ATCGAGTTGT CATAGTGTAT TTTTTCTCTT GGTTGTTGTG
AGAGTGTCTG AATTACTCTC ATCACCAATT TATGTCAATA TCACATTATT TTCTATAACT CAATAGAAGA TTAGACATCT
GCGCTGTCTG TTTCAACTGT Gaatatgaca tgataggtta atatgtaata tatcacttca caaacatgca agttcaaatt
cgacttctac aagttataac aaaaagtcaa aaaataacaa atttgactgt gaatatacgt atactagtta gagtttgatt
tgttattttt gttacaactt gtagaagtcg aatttgaact tgcatgtttg tgaagtgata tattacatat taacctatct
tgtgaatttt tttggaattt tttcataatc atttaggtgg catgcaagaa acgggtggac gtccacccaa gagattagaa
tccatcCTCC ATATATAAAG CATCTTTTAT ATTGCTTACG GACAACCTAG AGGCCTAGGA CCAGATTCTT GCCAGTTTTG
TGCCCATTGA TCACCTTTAC AGACATGCTA ACTTCCACTT GTTCATGACA ATAATATTTT CAGTGAGTAG CCTTTTGGGA
AGATAAACTT CTAATCTATT GAGAGTTTTG AATTCTTCAT GCAAACTATC GTAGTATTGT ATATATATTG ATAATATAAC
AATATTACTG AAAAGTTACA CAACAATTAC CAGATTCCAA ATTCCAAATG TAATGGCACA CTAAGGTGCT CCTGTTGTAT
CTTTTGATGG GCTCCCTTTT GTCCTTATTT ACTTGTTGCA TCATTCCTAA TTAGAAAATG ATGCTTGAAC TGCTAAAATC
AGATATTTGT AATACTAAAT GGAAAACCAC TGTGCTAATT AGGTATGTGC TTGTGTTCGG AAATTAACTT GGTCATTCCT
TTTTTTTTCA ATAGATTGAG CATACCCGTA GTGGATTGGA ACCTTTTGTT GTTGCTGCAA TTCCTACAAT GAAGTACAGC
TACGAGGCCT TCCAATCAAA AGATGATGCC CAGTAAGTGT ACTGTATACT GTAGAGCTAC TTACGTGCTT CCATCTTTTG
GTCTCCTGTC TATCATGTTT GCCTGTTCTG GATTGGCAGC AAACTTCATG AGGTAGTATC TGCAACTGTC CAGTTACCTG
CATCAAACTT TCTTTGCTCT GCTGGAATGC CTGTACAGTT TTTCTTTTCG ACAATTGTCA GTGAAATTCA CTGAAAAGAA
TATTCAAGAA GTTTGTTAGT GTGCATAATA TGTTAATATT AGATGAACAA TTGCAAACAA CTCCATTCCA AAAATGATGA
TCCGATGCTG ATAGCCTGAA AAATATTTCA TATTTAATAT TGGTGATCTC ATGTGTTGTG AAGCATGTGG TACAGCTGGC
TAAGAAACTG AAATATGTTG GAACAACTCA CCAGCCAGAC TAGCTCTCTA GTTGTGATTT ACAAGCTATA TAGCATACTA
GTGCTTTTGG GAACAAGAAT TGCATGAGCT ATCTGTTGTT ATTCTTTTAT CCCATTTTTG AATGGAGGAA AGGAAAACAA
GCAGACCTGA TAATTGAACA TTGACCCATG CTTGCTAATC TAACATGACT ATTGAAGATA GTGAGCAATC AATCAAATAA
AACTACTGGT AGCCTAAAAA AAACACCGGT GAAATTGATA CAGATAATCA TCAGAGTTTT TGTGTGTATG TGTGCTTGTG
TTTCATGATG TATCGGATAT GCATAACATG AATTATGTGT GGAAAAGAGG GCAGTTGAAT AGAATTATAT TTTTGATTAA
AAACGGTCTC TAGCACTTAT TTGGTGAACA GAATAGCACT GGACCTGCAT ATGCTTCGCT GTCTTTTCTT TTTTATCTTG
GATCTGTGTC TTCATGGCAA GAAGTTACTT TCTTGTCCAA CAGATATCAT TTGTAACCGA GTCTTCCCTG CCAAAAAATG
GAATAATCAA GAGAAAATAC CATTTTGTGT TAGGATTTAT ATTACTGGGC TGACTATCAT GTCAAAAATA ATATTACTGG
TTGATGATTA TGGTTCCTTA TTTGTGCTGC GACATGCTCG GAGAAAGTTA CCATCTTGCA GAAATAATGT TATAAGCTAT
TTGACCTTTT TTTTTTGTTT AACAGGTGCT CCATATGTTT AGGTGAATAC AATGAGAAAG AGATTCTGCG CATCATGCCC
AAATGCCGTC ATAATTTTCA TCTTTCCTGT ATAGATGTAT GGTTACAAAA GCAAACTACT TGTCCGATAT GCCGGATCTC
ATTGAAGGAC CTACCCAGTG GAAAACCTGC CGAGTCCCCT GTCCGTAGTC TCCCTCAACT ATTCAGCCAC CCTGAAAGCT
CAGTGAGTCG ATCACCTCAT TGGATACTTC CTATCCATCG TGATCGTACT GGAGGTAGAG AAAGCAGCCC GGCTTCACAA
GAAACAGTAG AGGTGGTCAT TGAAATCCAA CAAGAAATGC ACTGAGGACA TGGATGTATA GAGGCGAGAT ATCGATAGAA
GTTGATGAAA CTATTTTGTT TTTCGGTTGA GCAACAAAGA TATCTTCTAT TGCAGAAACG CCGTGCGTTC TTCCAGCAGC
AGGGCAGCAC GTACACGGCT TTGGCACAGA ATTGCAAGGA ATTTGTTTAC GACAGGACTG GATTTTAGGC ATTCTTTGTA
CATTTGAGGG TGTAGATTAG CGGGTTGCCT TTTGCCCCTC TGTTCATTTT TTATGTGTCC TTGATGTATA GTGTAAAAGG
AAGCATTAAC AATACTGATC AGATTCGGGG CCGCGAAAAT ATTTGTAGCA GCGCCGTT

Locus: Os02g0676500

Loading...

Locus: Os02g0676500

Loading...