Os02t0695800-01

Locus

Os02g0695800

Description

Similar to oligopeptide transporter 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT8

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 8

Transcript Evidence

AK071310 (DDBJ, Best hit)

Protein Evidence

NP_001152089.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023083N24 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0695800-01)

Others

Oryzabase (12493)

Transcript

1751 bp

>Os02t0695800-01 Similar to oligopeptide transporter 4.
CGCTGACATCCATCTCATGGGTGTGCTGGGTCTTCTCCAAGTCCGTCACGGCGCAACAGC
TGGGCTCCGGCTTGAAGGGCTTGGGCGTTGGGGCCTTCTCGCTCGACTGGACAGCTATCT
CTTCCTTCCTCTTCAGCCCGCTCATCTCGCCCTTCTTTGCCACCGCCAACATCTTCGTCG
GCTTCGTGCTCTTCCTCTATGTGCTCGTTCCCATAGCATACTGGGGTTTCGACCTGTACA
ATGCCAAGACATTCCCCATCTTCTCCTCGCACCTATTCATGTCCAATGGCACGAGCTACG
ATATCACAGCCATCGTGAACGACAAGTTTGAGCTTGATATCGATGCTTACAATAAGCTTG
GCAGGATCAACCTCAGTGTGTTCTTCGCGCTCGCTTATGGTCTAAGTTTTGCCACCATTG
CCTCCACTGTCACCCACGTCGGCCTCTTCTATGGAAAGGAAATCTATCACCGTTTTCGAG
CTTCGCAGAAGGAGAAGCCTGATATCCACACTAGGCTGATGAAGAAGTACGATGACATAC
CAGTGTGGTGGTTCTACTCACTGATGGCGCTTTCGATGACAGTGGCACTTATCCTCTGCA
CTGTCCTGAAGCATGAGGTCCAGCTTCCATGGTGGGGTCTACTATTTGCCTGTGGCATGG
CCTTCATCTTCACCCTACCCATCAGCATCATCTCTGCGACAACCAACCAGACACCTGGTC
TGAACGTCATCACGGAGTATGCCATTGGGTTGATAATCCCTGGTCATCCCATCGCCAACG
TCTGTTTCAAGGTGTATGGCTACATGAGCATGTCTCAGGCTATTGCCTTCCTCTCAGACT
TCAAACTTGGCCACTATATGAAGATTCCCCCAAAATCCATGTTCCTAGTTCAGTTTATTG
GCACAATTGTGGCCGGCACGGTCAACCTTGGGGTGGCATGGTGGCTGCTCGGCTCCATCC
ATGACATTTGTCAGGATTCGCTCCCAGCTGACAGCCCATGGACATGCCCCAACGACCGAG
TCTTCTTCGATGCATCGGTCATTTGGGGCCTCATTGGCCCAATCCGCATCTTTGGACCAC
ATGGCAACTACAGTGCCCTCAACTGGTTCTTCCTCATCGGCGCAGCAGGCCCTGTTATCG
TGTACATCTTCCACAAGATGTTCCCAAACAAGAAATGGATAACACTGACTAACTTACCAG
TGCTCATCGGCGCGACAGCCTCAATGCCACCGGCGACGGCTGTGAATTACAACTCTTGGC
TGCTCTTTGGTACCATCTTCAATTTCTTCGTGTTCCGGTACCGGAAGAAGTGGTGGGAGA
GGTACAACTACATTCTCTCTGCCGCACTCGACGCTGGCGTGGCTTTCATGGCGGTGCTGC
TGTACTTCTCACTATCCATGGAGAACCGGAGCATCGACTGGTGGGGCACGGCAGGAGAAC
ACTGCCCACTGGCCACATGTCCCACTGCAAAAGGGGTTGACTTGGGTCCAACAAGCGTTT
GCCCTGTGTTCTAAGCTAAATCTCTACTTCATGCTACAAGGTACAGCTGCAGGATAGTTA
TGATCCATTCGAGTTATGTTTACAGTCTTTAGATTCCAGCTTCATGGAAGTAAATCCTCT
GGTATGTGTAAAGGTTATAGGTTGATATTGCATCGCGCACAAGGCAAAAGAATTGAACAA
TGCTGGAACATAAATGCTGTAATATACCAGGTCATTTGGGCAATGCAAAGGCATATGTTG
GTACTTGAATG

CDS

1512 bp

>Os02t0695800-01 Similar to oligopeptide transporter 4.
CTGACATCCATCTCATGGGTGTGCTGGGTCTTCTCCAAGTCCGTCACGGCGCAACAGCTG
GGCTCCGGCTTGAAGGGCTTGGGCGTTGGGGCCTTCTCGCTCGACTGGACAGCTATCTCT
TCCTTCCTCTTCAGCCCGCTCATCTCGCCCTTCTTTGCCACCGCCAACATCTTCGTCGGC
TTCGTGCTCTTCCTCTATGTGCTCGTTCCCATAGCATACTGGGGTTTCGACCTGTACAAT
GCCAAGACATTCCCCATCTTCTCCTCGCACCTATTCATGTCCAATGGCACGAGCTACGAT
ATCACAGCCATCGTGAACGACAAGTTTGAGCTTGATATCGATGCTTACAATAAGCTTGGC
AGGATCAACCTCAGTGTGTTCTTCGCGCTCGCTTATGGTCTAAGTTTTGCCACCATTGCC
TCCACTGTCACCCACGTCGGCCTCTTCTATGGAAAGGAAATCTATCACCGTTTTCGAGCT
TCGCAGAAGGAGAAGCCTGATATCCACACTAGGCTGATGAAGAAGTACGATGACATACCA
GTGTGGTGGTTCTACTCACTGATGGCGCTTTCGATGACAGTGGCACTTATCCTCTGCACT
GTCCTGAAGCATGAGGTCCAGCTTCCATGGTGGGGTCTACTATTTGCCTGTGGCATGGCC
TTCATCTTCACCCTACCCATCAGCATCATCTCTGCGACAACCAACCAGACACCTGGTCTG
AACGTCATCACGGAGTATGCCATTGGGTTGATAATCCCTGGTCATCCCATCGCCAACGTC
TGTTTCAAGGTGTATGGCTACATGAGCATGTCTCAGGCTATTGCCTTCCTCTCAGACTTC
AAACTTGGCCACTATATGAAGATTCCCCCAAAATCCATGTTCCTAGTTCAGTTTATTGGC
ACAATTGTGGCCGGCACGGTCAACCTTGGGGTGGCATGGTGGCTGCTCGGCTCCATCCAT
GACATTTGTCAGGATTCGCTCCCAGCTGACAGCCCATGGACATGCCCCAACGACCGAGTC
TTCTTCGATGCATCGGTCATTTGGGGCCTCATTGGCCCAATCCGCATCTTTGGACCACAT
GGCAACTACAGTGCCCTCAACTGGTTCTTCCTCATCGGCGCAGCAGGCCCTGTTATCGTG
TACATCTTCCACAAGATGTTCCCAAACAAGAAATGGATAACACTGACTAACTTACCAGTG
CTCATCGGCGCGACAGCCTCAATGCCACCGGCGACGGCTGTGAATTACAACTCTTGGCTG
CTCTTTGGTACCATCTTCAATTTCTTCGTGTTCCGGTACCGGAAGAAGTGGTGGGAGAGG
TACAACTACATTCTCTCTGCCGCACTCGACGCTGGCGTGGCTTTCATGGCGGTGCTGCTG
TACTTCTCACTATCCATGGAGAACCGGAGCATCGACTGGTGGGGCACGGCAGGAGAACAC
TGCCCACTGGCCACATGTCCCACTGCAAAAGGGGTTGACTTGGGTCCAACAAGCGTTTGC
CCTGTGTTCTAA

Protein

504 aa

>Os02t0695800-01 Similar to oligopeptide transporter 4.
LTSISWVCWVFSKSVTAQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVG
FVLFLYVLVPIAYWGFDLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLG
RINLSVFFALAYGLSFATIASTVTHVGLFYGKEIYHRFRASQKEKPDIHTRLMKKYDDIP
VWWFYSLMALSMTVALILCTVLKHEVQLPWWGLLFACGMAFIFTLPISIISATTNQTPGL
NVITEYAIGLIIPGHPIANVCFKVYGYMSMSQAIAFLSDFKLGHYMKIPPKSMFLVQFIG
TIVAGTVNLGVAWWLLGSIHDICQDSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPH
GNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASMPPATAVNYNSWL
LFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAGEH
CPLATCPTAKGVDLGPTSVCPVF*

5'UTR

chr02:28584179..28584180 (- strand) : 2 bp

CDS

chr02:28583724..28584178 (- strand) : 455 bp

chr02:28583384..28583636 (- strand) : 253 bp

chr02:28583086..28583268 (- strand) : 183 bp

chr02:28582362..28582982 (- strand) : 621 bp

3'UTR

chr02:28582125..28582361 (- strand) : 237 bp

FASTA

>Os02t0695800-01 class=Sequence position=chr02:28582125..28584180 (- strand)
CGCTGACATC CATCTCATGG GTGTGCTGGG TCTTCTCCAA GTCCGTCACG GCGCAACAGC TGGGCTCCGG CTTGAAGGGC
TTGGGCGTTG GGGCCTTCTC GCTCGACTGG ACAGCTATCT CTTCCTTCCT CTTCAGCCCG CTCATCTCGC CCTTCTTTGC
CACCGCCAAC ATCTTCGTCG GCTTCGTGCT CTTCCTCTAT GTGCTCGTTC CCATAGCATA CTGGGGTTTC GACCTGTACA
ATGCCAAGAC ATTCCCCATC TTCTCCTCGC ACCTATTCAT GTCCAATGGC ACGAGCTACG ATATCACAGC CATCGTGAAC
GACAAGTTTG AGCTTGATAT CGATGCTTAC AATAAGCTTG GCAGGATCAA CCTCAGTGTG TTCTTCGCGC TCGCTTATGG
TCTAAGTTTT GCCACCATTG CCTCCACTGT CACCCACGTC GGCCTCTTCT ATGGAAAGTA AGATATTCTC TGATCAGTAC
ATAAATACAT GAAACAATCA CACGGTACAT CTTCTGTATC TGAACCGGAC AAACAAATGT GCAGGGAAAT CTATCACCGT
TTTCGAGCTT CGCAGAAGGA GAAGCCTGAT ATCCACACTA GGCTGATGAA GAAGTACGAT GACATACCAG TGTGGTGGTT
CTACTCACTG ATGGCGCTTT CGATGACAGT GGCACTTATC CTCTGCACTG TCCTGAAGCA TGAGGTCCAG CTTCCATGGT
GGGGTCTACT ATTTGCCTGT GGCATGGCCT TCATCTTCAC CCTACCCATC AGCATCATCT CTGCGACAAC CAACCAGGCA
AGCTATGTTA GAATTTGAGG CATTTCACTA GAACAGAACT GTCAGTGCAC TCTACTGCAT TTTAATAGCT TAAGTAACAA
AATCTGAAAA TGATTTAAAA TGTCATCTAC AGACACCTGG TCTGAACGTC ATCACGGAGT ATGCCATTGG GTTGATAATC
CCTGGTCATC CCATCGCCAA CGTCTGTTTC AAGGTGTATG GCTACATGAG CATGTCTCAG GCTATTGCCT TCCTCTCAGA
CTTCAAACTT GGCCACTATA TGAAGATTCC CCCAAAATCC ATGTTCCTAG TTCAGGTATA AACAGAAGTC CCAACTCACT
CATAAGGATT TGTTGACAAC CATGTTAGCA TGCAAGACGA CATATTTTAC TAACCTTGAG GGTACTGTTT TTACTCAGTT
TATTGGCACA ATTGTGGCCG GCACGGTCAA CCTTGGGGTG GCATGGTGGC TGCTCGGCTC CATCCATGAC ATTTGTCAGG
ATTCGCTCCC AGCTGACAGC CCATGGACAT GCCCCAACGA CCGAGTCTTC TTCGATGCAT CGGTCATTTG GGGCCTCATT
GGCCCAATCC GCATCTTTGG ACCACATGGC AACTACAGTG CCCTCAACTG GTTCTTCCTC ATCGGCGCAG CAGGCCCTGT
TATCGTGTAC ATCTTCCACA AGATGTTCCC AAACAAGAAA TGGATAACAC TGACTAACTT ACCAGTGCTC ATCGGCGCGA
CAGCCTCAAT GCCACCGGCG ACGGCTGTGA ATTACAACTC TTGGCTGCTC TTTGGTACCA TCTTCAATTT CTTCGTGTTC
CGGTACCGGA AGAAGTGGTG GGAGAGGTAC AACTACATTC TCTCTGCCGC ACTCGACGCT GGCGTGGCTT TCATGGCGGT
GCTGCTGTAC TTCTCACTAT CCATGGAGAA CCGGAGCATC GACTGGTGGG GCACGGCAGG AGAACACTGC CCACTGGCCA
CATGTCCCAC TGCAAAAGGG GTTGACTTGG GTCCAACAAG CGTTTGCCCT GTGTTCTAAG CTAAATCTCT ACTTCATGCT
ACAAGGTACA GCTGCAGGAT AGTTATGATC CATTCGAGTT ATGTTTACAG TCTTTAGATT CCAGCTTCAT GGAAGTAAAT
CCTCTGGTAT GTGTAAAGGT TATAGGTTGA TATTGCATCG CGCACAAGGC AAAAGAATTG AACAATGCTG GAACATAAAT
GCTGTAATAT ACCAGGTCAT TTGGGCAATG CAAAGGCATA TGTTGGTACT TGAATG

Locus: Os02g0695800

Loading...

Locus: Os02g0695800

Loading...