Os02t0699300-01

Locus

Os02g0699300

Description

Similar to ADP-ribosylation factor-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARFB1D

CGSNL Gene Name

ADP-RIBOSYLATION FACTOR B1D

Oryzabase Gene Symbol Synonym(s)

OsARFB1d, ARFB1d

Oryzabase Gene Name Synonym(s)

ADP-ribosylation factor B1d

Transcript Evidence

AK067761 (DDBJ, Best hit)

Protein Evidence

NP_001150662.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, ARF/SAR type (IPR006689)

Small GTPase superfamily, ARF type (IPR024156)

Full-length cDNA

J013119O04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0699300-01)

RiceXPro (AK067761)

Others

Oryzabase (21010)

KEGG (Os02t0699300-01)

Transcript

2129 bp

>Os02t0699300-01 Similar to ADP-ribosylation factor-like protein.
CTTGCCTCAAGTCCCTCAACAAACGAACGCTGCTTTTCGACGAAGAAAAGGAGGGTTCCT
CGCTCTGACGCCTTGCGCAGTTGTACCGTACATTCGTACTACCACACAGCTTGAAGAAGA
AGAGGGAATTCGACGAGAAATAGTAGAAGCTTGGCGTTCGTGCGAGGAATTCTCGGTGGT
TGATCGATCCGTGTTTCGCGGCGGATGGGGCAGGCGTTCCGCAAGCTGTTCGATGCCTTC
TTCGGCACCAGCGAGATGAGGGTCGTGATGCTTGGGCTGGATGCCGCGGGCAAAACCACC
ATCCTGTACAAGCTGCACATCGGGGAGGTCCTTTCGACTGTTCCTACGATTGGGTTCAAT
GTTGAGAAAGTACAGTACAAGAACGTGATGTTTACAGTATGGGATGTCGGTGGCCAAGAG
AAGTTGAGGCCTCTGTGGAGGCATTACTTCAATAATACGGATGGTTTGGTATGTTTTGTT
TCCTTTGTGGTTATCTTTTTGGGAATACGTGAAAGATTTGTGCATCGTTGCATTAAAGAA
GGAAAGAAGTGGTTATTTGATTTTGACAGACTTGTGTAATGATATAGTATTATATAGCCA
TTCTGCATAGGTTATTGTGGTTGACTTTGAGACAAATATTTCTTAGTTTGACTTATTGGT
TAAAGTTGTATGGCATGTATGCAATTGTTTTATCCAAAGTATCCATAAGGCTGGTGAGGT
TGCTAGATGATCCTTTGAACATTTTTAATTAAAAAATTAAATGCATACCAATATTGATAC
CGCAAATATGTGTGTTTAAAATCTATGGTAATTCGATTTGAATTTATGTGGAGTTATAGA
ACTCATTTATTTAAACAATTATGATAGTGAGATAACCCAAATGAGTGGTATAGAATTTCC
CAGTTCTCTTTTAATTAACATGAAAACTTACGGATCTAGAAGTACCCTGTGCTTGGCATA
CTATCTATTTTCATGTAATGGTATTGTAATATAATATAATCATGCTTAATTATCCAGTTA
ATGGATAATGTTGTCGAGTTTGTCAGATCTTTCACTGTATGAGATTATAGCAATGTTTCT
ACTAATTCAACACTTAATGAATTGCTCTTTTGTTGATACTGTAAATGATATCTTTGCTTG
ATTTGATTTGGTTTGATTTATTACAGCTGAACAGAGCCATCTTTCCAGATATAAGCTCAT
TCTGGATTATTTTGTGCTATATTACCTAATGAAGTTACTAATTAGCTAATGTTATGTCTA
TAATGTAAACCATACTACTCTTCAGTTACTAATTAGATGATGCTCGTCAGTAAAACTTTA
TTCTATTTTCTTGTTGATTTGTTTTCCTTGAGAGATCGGCGTGATACTGAAATTCGGATG
TATTCATGAGCATACCCAACTACATTTATAAATTGTAATAGCAACTTATTCCTATATGTT
ATTTTTGCACGTTCTGATTTGCAGATCTATGTAGTTGATTCATTGGATAGAGAGAGAATC
GGAAAAGCGAAAGCGGAGTTTCAGGCAATCGTTAATGATCCTTTGATGCTTAACAGTGTA
ATATTGGTATTTGCCAATAAACAAGATATGAAAGGGGCAATGACGCCGTTGGAGGTGTGC
GAAGGCCTTGGCCTCTATGATTTAAAGAATCGCATCTGGCATATCCAAGGCTCTTGTGCC
CTCAAAGGTGATGGTCTTTATGAGGGCTTGGACTGGTTGGCAAGTACTCTGAAGGGACTG
GAAGCCTCAGGTCGCCTCCCCTCAGGAGGGACCTCATTGTTCTAAGTAGCAGGTCTGCCT
GTAAGATTCTTCCGTTGACACTAACAATCTTTGCATCAAAGATGATCATGGGAACAAATT
ATCTTGGTGTGGAAGGCCTTACATGGTCACACCTTACATTGCTCAGGCGATATGCTTCGC
GGTGTCGATTCTACTGAAGGCAAAAGATGCATGAGAGCCTGACTACTTGAAACATTACCA
CTGCAGTTTTGTCATGGGTAGTAGTGTAGTAGTACCCATCGAGTCTTGTGAATTTCCTTG
AATGTTACAGCTAACTATCGGATGCATTTGTTCACATGTGATGAGTGAAACGCATGTTGA
TGTAAAAAGTTTGTGTAAAGTTATGTTTG

CDS

375 bp

>Os02t0699300-01 Similar to ADP-ribosylation factor-like protein.
ATGGGGCAGGCGTTCCGCAAGCTGTTCGATGCCTTCTTCGGCACCAGCGAGATGAGGGTC
GTGATGCTTGGGCTGGATGCCGCGGGCAAAACCACCATCCTGTACAAGCTGCACATCGGG
GAGGTCCTTTCGACTGTTCCTACGATTGGGTTCAATGTTGAGAAAGTACAGTACAAGAAC
GTGATGTTTACAGTATGGGATGTCGGTGGCCAAGAGAAGTTGAGGCCTCTGTGGAGGCAT
TACTTCAATAATACGGATGGTTTGGTATGTTTTGTTTCCTTTGTGGTTATCTTTTTGGGA
ATACGTGAAAGATTTGTGCATCGTTGCATTAAAGAAGGAAAGAAGTGGTTATTTGATTTT
GACAGACTTGTGTAA

Protein

125 aa

>Os02t0699300-01 Similar to ADP-ribosylation factor-like protein.
MGQAFRKLFDAFFGTSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VMFTVWDVGGQEKLRPLWRHYFNNTDGLVCFVSFVVIFLGIRERFVHRCIKEGKKWLFDF
DRLV*

5'UTR

chr02:28755172..28755375 (+ strand) : 204 bp

CDS

chr02:28755376..28755432 (+ strand) : 57 bp

chr02:28755552..28755642 (+ strand) : 91 bp

chr02:28756022..28756248 (+ strand) : 227 bp

3'UTR

chr02:28756249..28757193 (+ strand) : 945 bp

chr02:28757274..28757339 (+ strand) : 66 bp

chr02:28758006..28758544 (+ strand) : 539 bp

FASTA

>Os02t0699300-01 class=Sequence position=chr02:28755172..28758544 (+ strand)
CTTGCCTCAA GTCCCTCAAC AAACGAACGC TGCTTTTCGA CGAAGAAAAG GAGGGTTCCT CGCTCTGACG CCTTGCGCAG
TTGTACCGTA CATTCGTACT ACCACACAGC TTGAAGAAGA AGAGGGAATT CGACGAGAAA TAGTAGAAGC TTGGCGTTCG
TGCGAGGAAT TCTCGGTGGT TGATCGATCC GTGTTTCGCG GCGGATGGGG CAGGCGTTCC GCAAGCTGTT CGATGCCTTC
TTCGGCACCA GCGAGATGAG GGTATGGGTG ATTTTTCTTT TTTTTGTTTG TCAAAAGTAA GAAGAATATT CTCTTTTTTT
TTGGGTGTGT TCTTCGAGAA CTTCTTGATT GATTTTTGCT CTGTGACGCT TGCTCTTTAG GTCGTGATGC TTGGGCTGGA
TGCCGCGGGC AAAACCACCA TCCTGTACAA GCTGCACATC GGGGAGGTCC TTTCGACTGT TCCTACGATT GGTATGTTGC
TGATTACTTT GTCGCAATAT TTTTTTTTTC GCTCATGTCC TCTGTGCGAA ATTCGAAGTT AAATCAAGGC TTTACGGTTA
AACTAGTCAA GAAGTTAACT CCGTCGGCAG CAGAGGGGCA AAAAGAATTA TGAACTCCAC ATGGATTAGC AAGATGGGGG
AAGAATCTGA TATTTCTGAT TAGCAAGCAT CGATTTGCCC TTAAGATAGC AATTATCCTA TGAGAGACAA CCAGTTAGTT
TGCTCATCAG ACTGGCCTTA ACGCTTAACA GATATTATCA TCATGGCTTT TATGGGGTTA TTTGAAAAAT CTGACATCTC
ACTTTGCTGG GACACTGATT GATGCTTCTG CCTTTGTGCT GTACCACCAG GGTTCAATGT TGAGAAAGTA CAGTACAAGA
ACGTGATGTT TACAGTATGG GATGTCGGTG GCCAAGAGAA GTTGAGGCCT CTGTGGAGGC ATTACTTCAA TAATACGGAT
GGTTTGGTAT GTTTTGTTTC CTTTGTGGTT ATCTTTTTGG GAATACGTGA AAGATTTGTG CATCGTTGCA TTAAAGAAGG
AAAGAAGTGG TTATTTGATT TTGACAGACT TGTGTAATGA TATAGTATTA TATAGCCATT CTGCATAGGT TATTGTGGTT
GACTTTGAGA CAAATATTTC TTAGTTTGAC TTATTGGTTA AAGTTGTATG GCATGTATGC AATTGTTTTA TCCAAAGTAT
CCATAAGGCT GGTGAGGTTG CTAGATGATC CTTTGAACAT TTTTAATTAA AAAATTAAAT GCATACCAAT ATTGATACCG
CAAATATGTG TGTTTAAAAT CTATGGTAAT TCGATTTGAA TTTATGTGGA GTTATAGAAC TCATTTATTT AAACAATTAT
GATAGTGAGA TAACCCAAAT GAGTGGTATA GAATTTCCCA GTTCTCTTTT AATTAACATG AAAACTTACG GATCTAGAAG
TACCCTGTGC TTGGCATACT ATCTATTTTC ATGTAATGGT ATTGTAATAT AATATAATCA TGCTTAATTA TCCAGTTAAT
GGATAATGTT GTCGAGTTTG TCAGATCTTT CACTGTATGA GATTATAGCA ATGTTTCTAC TAATTCAACA CTTAATGAAT
TGCTCTTTTG TTGATACTGT AAATGATATC TTTGCTTGAT TTGATTTGGT TTGATTTATT ACAGCTGAAC AGAGCCATCT
TTCCAGATAT AAGCTCATTC TGGATTATTT TGTGCTATAT TACCTAATGA AGTTACTAAT TAGCTAATGT TATGTCTATA
ATGTAAACCA TACTACTCTT CAGTTACTAA TTAGATGATG CTCGTCAGTA AAACTTTATT CTATTTTCTT GTTGATTTGT
TTTCCTTGAG AGATCGGCGT GATACTGAAA TTCGGATGTA TTCATGAGCA TACCCAACTA CATTTATAAA TTGTAATAGC
AACTTATTCC TATATGTTAT TTTTGCACGT TCTGATTTGC AGATCTATGT AGTTGATTCA TTGGATAGAG AGAGAATCGG
AAAAGCGAAA GCGGAGTTTC AGGTTTAATA AGCTATTTTA AGTTATGCTC ATCAGATAGC TTGCCTTGTT AGTGAAGCTA
AGGTTTGGTG GCTTTGTTGC AGGCAATCGT TAATGATCCT TTGATGCTTA ACAGTGTAAT ATTGGTATTT GCCAATAAAC
AAGATATGGT AAGTCAACAG CACTTGAGAA CTCCTTTTGT GTTTTAACAT GAACGTGCTC TTTTTTTTTT TTTTTTTGCG
GGGCAACACG TGCTTGAATG CACATGTGTT TGAAACCTGT GAACATGTTC CGTATTGCCA TCCATAAATG TATTTCCCAG
CATTCATTCA TATAACAAAG AGGATTGTTT TACTTCTCTA GACTGTTGTG AACGTTGTAT GAAGGTAAAC AGGTAGTGTT
ACTCGTGAGC TGTTTGCATC ATGTGATCTT TTACATTCGT GGAAAGATAT GATGTCCCAC AATTTTTCAT CTATAATAGT
GTTGTAAAGT TGCACCTTAT TTGGTTTTGT GTTGGGTTGC TATTGATTCC AGTAATTTAG TTCAATACAC GAATGGATGA
GATTGTGCTT CTGTGGCATG TCTGAATCTG ATGTGACTGC ACCAGTAATG CTAGTTGCCA TCAAACATAC CATAATAGGA
TGCAGGTTGC CATATTTTTT AAGGATGATA TCTGAACAAA TAGATGATGA CAGAATCTGA ATATGCGGTG AAGCCTTTGA
AACTTTTTCA TAGGATGGCA TGTTTGCCCT CTAGTATTTA CTACTACTAG TAATTAGAAC GATCTATGCC GAATTGCTGA
TCCTGTCTAA TGCAGCATTC CTTTGTTTTG TCAGAAAGGG GCAATGACGC CGTTGGAGGT GTGCGAAGGC CTTGGCCTCT
ATGATTTAAA GAATCGCATC TGGCATATCC AAGGCTCTTG TGCCCTCAAA GGTGATGGTC TTTATGAGGG CTTGGACTGG
TTGGCAAGTA CTCTGAAGGG ACTGGAAGCC TCAGGTCGCC TCCCCTCAGG AGGGACCTCA TTGTTCTAAG TAGCAGGTCT
GCCTGTAAGA TTCTTCCGTT GACACTAACA ATCTTTGCAT CAAAGATGAT CATGGGAACA AATTATCTTG GTGTGGAAGG
CCTTACATGG TCACACCTTA CATTGCTCAG GCGATATGCT TCGCGGTGTC GATTCTACTG AAGGCAAAAG ATGCATGAGA
GCCTGACTAC TTGAAACATT ACCACTGCAG TTTTGTCATG GGTAGTAGTG TAGTAGTACC CATCGAGTCT TGTGAATTTC
CTTGAATGTT ACAGCTAACT ATCGGATGCA TTTGTTCACA TGTGATGAGT GAAACGCATG TTGATGTAAA AAGTTTGTGT
AAAGTTATGT TTG

Locus: Os02g0699300

Loading...

Locus: Os02g0699300

Loading...