Os02t0700700-01

Locus

Os02g0700700

Description

Disease resistance/zinc finger/chromosome condensation-like region domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BRXL2

CGSNL Gene Name

BREVIS RADIX-LIKE 2

Oryzabase Gene Symbol Synonym(s)

OsBRXL2

Oryzabase Gene Name Synonym(s)

Brevis radix-like 2, BRX-like 2

Transcript Evidence

AK101598 (DDBJ, Best hit)

Protein Evidence

Q6ZIK7 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Brevis radix-like domain (IPR013591)

Full-length cDNA

J033051H11 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0700700-01)

RiceXPro (AK101598)

Others

Oryzabase (8928)

KEGG (Os02t0700700-01)

Transcript

2099 bp

>Os02t0700700-01 Disease resistance/zinc finger/chromosome condensation-like region domain containing protein.
TGCTTTCGCTCGATTTCGGGGGCGGATCAGACGGCCGCGAGCGAATCCGGGGATCTCCCC
CCTCCCTCCCGCTCTGTTCCTGCCTCTGCTCCCCGCCCGTTTCCTCTCAATCCTTCCTTC
TCCCTGCTTCTCTCCCTCGCGGAAAAAAAAAGAAAAGAAAAGGAAAAGGGGGAGTGGAAA
AGATCTCCTCTTCGTCCTGTTTCTGTTGGCGTCGCTGCTCGGCAGCTCGTTCGCTAGCTA
CCACCCAAAAGGCGGCAGTCGATCGCCTGATAGCTCAGCCGCTCTCCTCTGTCGCTTCCG
AGCTCTTGTGCCGCCGCGCGCCGGCGAGGATCTGTCGACCGAGAGAGGAGCCACCCGCCG
TCCAAGAAGAGGAGGAAGAAGATCATCTTTGCGTCAGAAGGAGCAGTGACGAGATACCAC
TGTCCGCGTGGTCACAAGCATTGCTGCGAGACTGTGATTGGCGGGAGTTGCTTTGGATGA
GCAATAGCCTGATGGTGGCTTGCTAACTGGGAAGGAGGATTTGCGCGGTTCTGGACTACT
CGAGAGGCTAGGAAATGCTTGCGTGCATCGCGTGTTCGACCAAGGACGGCGGGGAGGGCG
GGCACCGGTCCGCCACCGCCACGCCCAACTCCGGCAAGTCTCTGACTTCACAGTTGAAGG
ACATGGTGCTCAAGTTCTCCGGCAGCGGCAGGCACCAATACAAGTCCGGCGGGAGCCCGT
CGTTGAGGACCAGCCGCTTCCACCGCTCCAGCCGCCTCGCCGCGTACCCGGGCATCATCG
ACGAGTCGGGCTTCACGTCGGACGGGGCCGGCGAGGCCTATACTTACATGAGGACGACGA
CGGCGAGCGCCGGCGCCCGGGCCGCGCCGTCGACGTGGGACTTGCCGCCCAAGGTGAACC
ACCGCAGCTTCCAgccgcgcgtgatcaggagcccgagcgcgagcggggtaccgagcatcg
gggaggaagactacgacgacgacgacgacgacgatgacgaggagacagtcctcctggagg
aggaccgcgtgccgcgggagtggacggcgcaggTGGAGCCCGGCGTGCAGATCACCTTCG
TCTCCATCCCCGGCGGCGCCGGCAACGATCTGAAGCGCATCCGTTTCAGCCGGGAGATGT
TTAACAAGTGGGAGGCGCAGCGGTGGTGGGGGGAGAACTACGACCGCGTGGTGGAGCTCT
ACAACGTGCAGACGTTCAGCCGGCAGCAGGGCTTCTCGACGCCGACGTCCTCCGTCGACG
AAGCCATGCAGAGAGATTCGTTCTACTCCCGCGTCGGCTCGACGAGGGAGAGCCCGGCGA
tgatgatgccgccgccgccgccgctgccgtcgtcgggtgctggcagggagcacccgatca
gccggacagcgtcgagcaaggcgcagctgtcgtcgtcgtcgtcggtggcggcggctcggc
cgccgttctacccgtccacggccgtgccggacccgtccgacCACGTGTGGGCGCACCACT
TCAACCTCCTCAACTCCGCGGCCGCCGGACCAGCGGCGCCGTACGACCCGTCGCGCGGCA
CGACGTCGTCCCGGGACGAGGCGTCCGTGTCCATCAGCAACGCGAGCGACCTGGAGGCCA
CGGAGTGGGTGGAGCAGGACGAGCCTGGGGTGTCCATCACCATCCGCGAGTTCGGCGACG
GCACCCGCGAGCTCCGCCGCGTCCGGTTCAGCCGCGAGAGATTTGGCGAGGAGCGGGCCA
AGGTGTGGTGGGAGCAGAACCGGGACCGGATACACGCGCAGTATCTGTGAGCTAACGCGA
GACCCATCGTTGATGAGAGTGAAGTGATACTGTGACAGAAGCTAACGCGTCGCCGGGAAG
AATAGTTAAGAGTGTGATGATACTACTACTTTGCCGCTGCTACGGTTAGTGCTACTAGGT
TTTTTTTACAGGGTGAATATAGGATGAGGGGGAAGGATGCTGTGGTCTGAGAAGCAGCAG
GCTCAGTCAAGCTGCTACTCTTGTTAACTGACCACTTTGGTCTTCCGTTTGTAACCTTTA
TGGACAGGGTGTTCGTTTAATTCGTTTGTTTTAGCATGGTTTCATGTGATCCTCGACGG

CDS

1236 bp

>Os02t0700700-01 Disease resistance/zinc finger/chromosome condensation-like region domain containing protein.
ATGCTTGCGTGCATCGCGTGTTCGACCAAGGACGGCGGGGAGGGCGGGCACCGGTCCGCC
ACCGCCACGCCCAACTCCGGCAAGTCTCTGACTTCACAGTTGAAGGACATGGTGCTCAAG
TTCTCCGGCAGCGGCAGGCACCAATACAAGTCCGGCGGGAGCCCGTCGTTGAGGACCAGC
CGCTTCCACCGCTCCAGCCGCCTCGCCGCGTACCCGGGCATCATCGACGAGTCGGGCTTC
ACGTCGGACGGGGCCGGCGAGGCCTATACTTACATGAGGACGACGACGGCGAGCGCCGGC
GCCCGGGCCGCGCCGTCGACGTGGGACTTGCCGCCCAAGGTGAACCACCGCAGCTTCCAg
ccgcgcgtgatcaggagcccgagcgcgagcggggtaccgagcatcggggaggaagactac
gacgacgacgacgacgacgatgacgaggagacagtcctcctggaggaggaccgcgtgccg
cgggagtggacggcgcaggTGGAGCCCGGCGTGCAGATCACCTTCGTCTCCATCCCCGGC
GGCGCCGGCAACGATCTGAAGCGCATCCGTTTCAGCCGGGAGATGTTTAACAAGTGGGAG
GCGCAGCGGTGGTGGGGGGAGAACTACGACCGCGTGGTGGAGCTCTACAACGTGCAGACG
TTCAGCCGGCAGCAGGGCTTCTCGACGCCGACGTCCTCCGTCGACGAAGCCATGCAGAGA
GATTCGTTCTACTCCCGCGTCGGCTCGACGAGGGAGAGCCCGGCGAtgatgatgccgccg
ccgccgccgctgccgtcgtcgggtgctggcagggagcacccgatcagccggacagcgtcg
agcaaggcgcagctgtcgtcgtcgtcgtcggtggcggcggctcggccgccgttctacccg
tccacggccgtgccggacccgtccgacCACGTGTGGGCGCACCACTTCAACCTCCTCAAC
TCCGCGGCCGCCGGACCAGCGGCGCCGTACGACCCGTCGCGCGGCACGACGTCGTCCCGG
GACGAGGCGTCCGTGTCCATCAGCAACGCGAGCGACCTGGAGGCCACGGAGTGGGTGGAG
CAGGACGAGCCTGGGGTGTCCATCACCATCCGCGAGTTCGGCGACGGCACCCGCGAGCTC
CGCCGCGTCCGGTTCAGCCGCGAGAGATTTGGCGAGGAGCGGGCCAAGGTGTGGTGGGAG
CAGAACCGGGACCGGATACACGCGCAGTATCTGTGA

Protein

412 aa

>Os02t0700700-01 Disease resistance/zinc finger/chromosome condensation-like region domain containing protein.
MLACIACSTKDGGEGGHRSATATPNSGKSLTSQLKDMVLKFSGSGRHQYKSGGSPSLRTS
RFHRSSRLAAYPGIIDESGFTSDGAGEAYTYMRTTTASAGARAAPSTWDLPPKVNHRSFQ
PRVIRSPSASGVPSIGEEDYDDDDDDDDEETVLLEEDRVPREWTAQVEPGVQITFVSIPG
GAGNDLKRIRFSREMFNKWEAQRWWGENYDRVVELYNVQTFSRQQGFSTPTSSVDEAMQR
DSFYSRVGSTRESPAMMMPPPPPLPSSGAGREHPISRTASSKAQLSSSSSVAAARPPFYP
STAVPDPSDHVWAHHFNLLNSAAAGPAAPYDPSRGTTSSRDEASVSISNASDLEATEWVE
QDEPGVSITIREFGDGTRELRRVRFSRERFGEERAKVWWEQNRDRIHAQYL*

5'UTR

chr02:28833252..28833632 (- strand) : 381 bp

chr02:28832643..28832770 (- strand) : 128 bp

chr02:28831035..28831079 (- strand) : 45 bp

CDS

chr02:28830936..28831034 (- strand) : 99 bp

chr02:28828003..28828478 (- strand) : 476 bp

chr02:28827769..28827910 (- strand) : 142 bp

chr02:28827257..28827696 (- strand) : 440 bp

chr02:28827048..28827126 (- strand) : 79 bp

3'UTR

chr02:28826739..28827047 (- strand) : 309 bp

FASTA

>Os02t0700700-01 class=Sequence position=chr02:28826739..28833632 (- strand)
TGCTTTCGCT CGATTTCGGG GGCGGATCAG ACGGCCGCGA GCGAATCCGG GGATCTCCCC CCTCCCTCCC GCTCTGTTCC
TGCCTCTGCT CCCCGCCCGT TTCCTCTCAA TCCTTCCTTC TCCCTGCTTC TCTCCCTCGC GGAAAAAAAA AGAAAAGAAA
AGGAAAAGGG GGAGTGGAAA AGATCTCCTC TTCGTCCTGT TTCTGTTGGC GTCGCTGCTC GGCAGCTCGT TCGCTAGCTA
CCACCCAAAA GGCGGCAGTC GATCGCCTGA TAGCTCAGCC GCTCTCCTCT GTCGCTTCCG AGCTCTTGTG CCGCCGCGCG
CCGGCGAGGA TCTGTCGACC GAGAGAGGAG CCACCCGCCG TCCAAGAAGA GGAGGAAGAA GGTAACTGAC CAGTGACTAC
TGCTGTTTCC TTTCCCCTTG AATCGGAGAA CGAGATCTTT GCCATCTCTT TCTCTGTTTC TTTTTTTATG GTGTGCATAT
TTGGAGTAGC TCCGTGTGTC CTGTGCTCTG CTCTAGTGTC CATTTGCTGC GCTTTCGTTT TCGGAGGGGG GTTCATCTCT
GGGTCCGTTT GCGTTGTCGA TCATTGAGAT CTCCAGCCTT CCATTGGGTC CATTTGGGGA GGCAATCCCA TTGCTTCCCA
CTGTTGCCTT TTTTTTCCGT AGCGTCGACA GCCTCTTGCA GCAATGAGTA CTGGCCTGTT TCTTTATAGA GTCAGGCTTG
TCGATTTGGA CAGCGAACAA TCGGCTAAAT ATCTGTCCTA GCAGTATTTT TGCAGATAAA AGTGAGCATT ATGCTTTTCT
AGTCGGCCAC ATGTACATTG CGTAATCTTT ATCACCTTCT CTTCCCTGTC GCTGTTGTTC AGATCATCTT TGCGTCAGAA
GGAGCAGTGA CGAGATACCA CTGTCCGCGT GGTCACAAGC ATTGCTGCGA GACTGTGATT GGCGGGAGTT GCTTTGGATG
AGCAATAGCC TGATGGTGGC TTGCTAACTG GTAAGCAGTA TTCTCACTTG TCGTCATCCA CACTTAACTA TATAATCAAT
CTTATCCATT GGTAATTACT CCTAGTACCC TTTGTAGTAT AACAAGCTTA AACTAAAAAC GGTAGTATTA CAATAGTACA
ATACACGCGA ATTTTGTAGG TGCAAGTAGG ACTGTTTTTT AGTTGGGATG TTACACTGCA AGAAGGCTTC TGTTTGCCTT
TCCATTTCCT TCAGTGGGTC CTCCAATCCA CTCCCAACCA CTGATAAAAT TTCCATGAGG GCCCTGGTCC TAAAAGGGCT
TCTCTCTATC CATGCAAATG TGCAATATGT GCATCATCCG TCTATCTATC TGCCTCCTGC TCAGCTCGAT CGGCCGCTCT
CCAAGCTTCC AACCTTTCGC TTGGAACTGG ACGATGCACT TGGATTCGGA GTGGCAGTGT CCTCACGTAG GAGTAGATAA
AAGAGCTCCT GCTAGTACAG TTTTTCTCAG AACCTTCTCT GCTCCCTCGT GTATTATCGG CATGCATGCC TTGGTTGCCT
GTTGCCTGTT GCTGCAGTAG CAAGCATAAT TAAGCCTATG CTTGTTGAGT GAATGAATGC TCTACCTACG ACGACGTACT
AGCTGCACGC CTGCACACTG AGCCCACCGG TGCAGCAGCA TTAAGCAGTA ATATCAATCC GTGCATGCAT CAATCAATCA
ATCCACCACC CGGGCTATAC TTTGCCGCAG CTACCTCCCT GTACCTCTCA TACTACGTAC TACTCCATAA AGCAGCCAAA
GCTTGGGGGG CATTGACTCC GTTTCTTGCT CGATGCCTCG CCTACCCCTA GCTAAGCCAG AGCTCAAACA TGGCAGTGGT
CTGCAGTGAG CCGGCGCGTG CAAACATGCG TTCGGGCCCA GGCCGGCCGC GCCAAGGCCC AAGGGCATGG ATATACACAC
GCGCGGGCGT GTGCGCCCCA TGGTGGCAGC GTACTCGGCT GGCGAGGGGT TGCTGTCGGT GTATCGATTT TAAGGAAGGC
AAAAGCCTGC GGCGCAGGCC ATGGCATGGC ATGCATTAGC TAGAGCGGCG TTTACTCACT GGCTATGGCT ACTCAGCTCG
GAGTTGATGC CGGCCGGCCG GCCGGCTGGC ACTGCAGCCA TGGCAGTGGC TGCAGTGTAA TCTGATGTAC CTGCTGCTAC
TAGAAATGTT CCGTGTATTT ACTCCTTGCA CACACTGGAT CAATGGCACT GCTACGTTGC TAGTACATGT TGGATTTTAG
CCGTGTGAGT GCGTGACGGC TCAGTTCCTC TTTTGATACA CCAGGACCAG ATTCTTATCT TAgggtgtgt ttgagagaga
gaggattggg aagattggga agatacacaa aacgaggtga gtcattagtt catgattaat taaatattaa ctattttaaa
ctttaaaaat ggattaatat gattttttaa agcaactttt ctatagaaaa tttttttaca aaaaacgcac cgtttagtag
tttgaaaagc gcggaaaacg agtgacaatc tccTCCCTTG GCTCTTCGAT GGACTTTGTT TGTGACTGAG CAGGGAAGGA
GGATTTGCGC GGTTCTGGAC TACTCGAGAG GCTAGGAAAT GCTTGCGTGC ATCGCGTGTT CGACCAAGGA CGGCGGGGAG
GGCGGGCACC GGTCCGCCAC CGCCACGCCC AACTCCGGCA AGTCTCTGAC TTCACAGGTA CATGTGCTGA TGTGCATTCT
TATACTACTC CAGTACTCCG TACACAAGTA AAAATCCGTA GTACTCGCAC ATGTTGTGCA CTAGCGCATG GGCGGAGACC
TGATGCCACA TTTTCTTCTG TTGCATTAAC CAGTCAATTG AATGCCCTCT GCTGCTCCTT AGCAGTGGGG TGCTAGTACT
TCTAGTActa catccgttcc aaaatatagc tatttctagc acagtacttt attttaaaat gaagctattt ttctacctat
cttttcctct caaccaatca caaccattct ttttcaccta ttttctcttt tcaaccaatc acacatattt ttcaatcatt
ctcatatact ttcttaatac ccgtgtcagc ctcaaaaatg cttacatttg ggacggagga GAAAGTATTA CACTGTAGTT
GTTCTTTTGT CCTAGCCTGC TTGTCGTCAC CTTGTTCTTG GCCTTTGAAA GGGAACAGAG TACCACTACG TACAGGAGGA
CAACCAATAC TAGTACACTT GTGGTGATAT ACACCGTTTC TCTTTTCTTT TCCCTTCCTC ACCGGGTGTC TAATCAGGGC
AATATCCTGC ATGGAATCAC AAGTACAAGG TGAATGACAG TGCTCTAACT ACATTTTAAA ACATTCCTTG ATAAAGTTGG
TCAAGGACTC AAGGCCCAGG GGAATATGAC TAGAGTTTGG TGGGGGAGAG AAGGCTCTTG CTTTTTTCTT GCATGGATCC
CCTCAAGCTT TGGGTTTTGG ACTGATTTGA TATGGTCACT TCTGTTCCCC CATACTACCA TTCCCCTGCC CTTTTCACTT
GCTCCATCCA TCCATCCATC CATTCACTTT GCTTGCTCCC AACAAAAGAC TGTCCTATCC TAGTAGCTGC TAATGTGATC
TTTCCCTCCT GGAAAGACAC TATCTGGTTG ATTGATCTTA ACCCCTGGGT CTTACTCCTA Cggcccgttt ggttggaggg
agtttttagt agggattggg aatttagagg gatgaagcta ttaaaatttt tgtttggttg ggagacatgg gaattttggt
gggatgagga tggggaattg aggaaggaac tcactccttt tcaataactg ggtaggggca ggtaattagg agggaattca
tcctttactt tgtttaacca aatctcagcc atccgttttt attaatgacc taatctccaa ctaaattccc tatcaatttc
tatcacctct accaaataag atattgggat taaaaatcaa attcccatct taatctcatc atcaactccc tcgtgtaaac
tcccaatccc cttcgagtta tcaaacaagc AGCTACTCTC TTCAGTCCAA GATGTTCCTT TCCCTTTTCT TTTCTTAAGA
GGGACCCCCC CCCCCCCCCC CCCAAGACGG TCCTGGACAC TCAGAGAAGA ATAAAGCTGG GCCGTAGCCA GCCCGTAGGC
CATGCACAGA AACACACACT TGTGGTCCTT GCGATGGGCT GGTTTGTTTC TTAAGATGGG CTCTCGCTGC GACCCATCTC
TGAACTACTC CATGATGACA CGCCTCGTCA CTGGGACTCG AGTACTCTCG TCCTTTGCTT CCTGCACGCT TTCGCCTTTG
CCGTCTTTTA AAGTAGCAGT ACTAGTACTA CACATATTTG GAGCATAAGC ACGCACCACA TGACATGCAC CTGTGTGGCT
ATGTGTGTGT GTGTGTGTGG ATGGACCGGA TCGATTCCCT TCCCTCTCTG GTGTTATTAT GATCCGGGGG GGGGGGGGGG
GGGGGGGCGC TGTCCACGAT GTTGCTTTGA GAAACTTGAG TGGTGTGGTG TGGGTGTGCT TTGTCTTTGC TTTGTTCCTT
GCTTGAGAGT TCAGGCAAAA GATGTCCTGG GTTTTAGGAC ATTGTGATGG TTTTGTTGGT GCTTTTCGGT GATGTGTGAG
CCCTTCTGCT AGGCGTCTAC GCGACTAATC TGGGGGTCGG AAGTGCGCCC TGTCCTGCTT TTGTTAGCCC TAATCATCGG
GATGGAGATG GAATCGATCG GTGATCATTA ACCCTGCTGT GGATATGATT GGCGCTTTAC TTGAGAGACC GAGCTGTCGC
GTAGGATTTG ATTGCTGAGG CGTGTGCGTT AGTGGTGAAT GTTGATGCCC CGAACGAAAC TCCCGCAGTT TTATATACTG
GAAAGGCAAT GGCATGTTAA AAGTTATATG CAGCCACTCT GTTGCCAATT GCAAGAAATT ATATTTACTG AATATGCAAG
GCAAAAATGT TACCTCAGAT ATATAATATC ATCTGTTGTA TGATGATGTC AACTTGGCAT TCGTTCAAAA AAAAAAAAGG
ATGATGTTAA CTTGACTAAT GGATATTTAA TAAATATTTT TACAATGGAA AATCAATTGA TCCCTTATTC AGGAGGATAA
TTAATTAATC TGCACAAATT TAATGTGGTT TCAGTTGAAG GACATGGTGC TCAAGTTCTC CGGCAGCGGC AGGCACCAAT
ACAAGTCCGG CGGGAGCCCG TCGTTGAGGA CCAGCCGCTT CCACCGCTCC AGCCGCCTCG CCGCGTACCC GGGCATCATC
GACGAGTCGG GCTTCACGTC GGACGGGGCC GGCGAGGCCT ATACTTACAT GAGGACGACG ACGGCGAGCG CCGGCGCCCG
GGCCGCGCCG TCGACGTGGG ACTTGCCGCC CAAGGTGAAC CACCGCAGCT TCCAgccgcg cgtgatcagg agcccgagcg
cgagcggggt accgagcatc ggggaggaag actacgacga cgacgacgac gacgatgacg aggagacagt cctcctggag
gaggaccgcg tgccgcggga gtggacggcg caggTGGAGC CCGGCGTGCA GATCACCTTC GTCTCCATCC CCGGCGGCGC
CGGCAACGAT CTGAAGCGCA TCCGTTTCAG GTTCGTGCCA ATCAAGCGAC ATGACATTTC GTCGAGCACG TGGTGCTCGA
GTGATGAGCA TGAGCTAACG GATTGTGGCG ATGCATATGC AGCCGGGAGA TGTTTAACAA GTGGGAGGCG CAGCGGTGGT
GGGGGGAGAA CTACGACCGC GTGGTGGAGC TCTACAACGT GCAGACGTTC AGCCGGCAGC AGGGCTTCTC GACGCCGACG
TCCTCCGTCG ACGAAGCCAT GCAGGTCACT TCCGTTCCAT CACTGGTTAG CAAAAGCTCT GCACATTCCG TTGCTGATGA
TGGTTGATGT TTGCAGAGAG ATTCGTTCTA CTCCCGCGTC GGCTCGACGA GGGAGAGCCC GGCGAtgatg atgccgccgc
cgccgccgct gccgtcgtcg ggtgctggca gggagcaccc gatcagccgg acagcgtcga gcaaggcgca gctgtcgtcg
tcgtcgtcgg tggcggcggc tcggccgccg ttctacccgt ccacggccgt gccggacccg tccgacCACG TGTGGGCGCA
CCACTTCAAC CTCCTCAACT CCGCGGCCGC CGGACCAGCG GCGCCGTACG ACCCGTCGCG CGGCACGACG TCGTCCCGGG
ACGAGGCGTC CGTGTCCATC AGCAACGCGA GCGACCTGGA GGCCACGGAG TGGGTGGAGC AGGACGAGCC TGGGGTGTCC
ATCACCATCC GCGAGTTCGG CGACGGCACC CGCGAGCTCC GCCGCGTCCG GTTCAGGCAA GCCACTCCAC AGTCCACACA
CACATCCCGA AAACGCTAAC ACGTCACCAA TACCGGCAGA TCACGCTGGA TTTTCCTCGT GTTCGCGTGG AATTTTTAAC
ACTTCTCTCT GTGCGCAACG TTGCAGCCGC GAGAGATTTG GCGAGGAGCG GGCCAAGGTG TGGTGGGAGC AGAACCGGGA
CCGGATACAC GCGCAGTATC TGTGAGCTAA CGCGAGACCC ATCGTTGATG AGAGTGAAGT GATACTGTGA CAGAAGCTAA
CGCGTCGCCG GGAAGAATAG TTAAGAGTGT GATGATACTA CTACTTTGCC GCTGCTACGG TTAGTGCTAC TAGGTTTTTT
TTACAGGGTG AATATAGGAT GAGGGGGAAG GATGCTGTGG TCTGAGAAGC AGCAGGCTCA GTCAAGCTGC TACTCTTGTT
AACTGACCAC TTTGGTCTTC CGTTTGTAAC CTTTATGGAC AGGGTGTTCG TTTAATTCGT TTGTTTTAGC ATGGTTTCAT
GTGATCCTCG ACGG

Locus: Os02g0700700

Loading...

Locus: Os02g0700700

Loading...