Os02t0703600-01

Locus

Os02g0703600

Description

Similar to Abscisic acid 8'-hydroxylase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ABA8OX1

CGSNL Gene Name

ABA-8'-HYDROXYLASE 1

Oryzabase Gene Symbol Synonym(s)

OsABA8OX1, CYP707A5, OsCYP707A5, ABA8ox1, OsABA8ox1

Oryzabase Gene Name Synonym(s)

Abscisic acid 8'-hydroxylase 1, ABA 8'-hydroxylase 1 ; Cytochrome P450 707A5, ABA 8'-hydroxylase1

Transcript Evidence

AK067007 (DDBJ, Best hit)

Protein Evidence

Q05JG2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Full-length cDNA

J013091D15 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0703600-01)

Others

Oryzabase (7251)

Transcript

2371 bp

>Os02t0703600-01 Similar to Abscisic acid 8'-hydroxylase 1.
TCCACACCCCCCCCAACAACACCACCGCCCATTTCCCTTTCTCTTCCTCTTCTTCTTCCT
TCTCCTCCTACTCCTCTGCGATTGACAAAGATAAGTGAAGTGAGCAGGCGCCAATGGGTG
CTTTTCTTCTGTTCGTGTGCGTGCTCGCGCCTTTCTTGCTTGTCTGCGCCGTCCGCGGCC
GCCGCCGGCAGGCGGGCTCGTCGGAAGCGGCGGCGTGCGGCCTGCCGCTGCCGCCGGGGT
CGATGGGGTGGCCGTACGTCGGGGAGACGTTCCAGCTGTACTCGTCCAAGAACCCCAACG
TGTTCTTCAACAAGAAGCGGAACAAGTACGGTCCCATCTTCAAGACGCACATCCTGGGAT
GCCCCTGCGTGATGGTGTCCAGCCCGGAGGCGGCGCGGTTCGTGCTGGTGACGCAGGCGC
ACCTCTTCAAGCCCACCTTCCCGGCGAGCAAGGAGCGGATGCTGGGTCCCCAGGCCATCT
TCTTCCAGCAGGGCGACTACCACGCCCACCTCCGCCGCATCGTCTCCCGCGCCTTCTCCC
CCGAGTCCATCCGCGCCTCCGTCCCGGCCATCGAGGCCATCGCGCTCCGCTCCCTCCACT
CCTGGGACGGCCAGTTCGTCAACACCTTCCAAGAGATGAAGACTTACGCGCTGAATGTGG
CATTGCTGTCCATCTTCGGGGAGGAGGAGATGCGCTACATCGAGGAGCTGAAGCAGTGCT
ACCTGACGCTGGAGAAGGGGTACAACtcgatgccggtgaacctgccgggcaccctgttcc
acaaggccatgaaggcccggaagaggctgggcgccattgtggcccacatcatctctgccc
ggcgcgagcggcagcgggggaacgacctgctagggtcgttcgtggacggccgcgaggccc
tcaccgacgcccagatcgccgacaacgtcatcggcgtcatcttcgccgcccgcgacacca
ccgccagcgtcctcacctggatggtcaagttcctcggcgaccaccccgccgtcctcaagG
CCGTCACCGAAGAGCAGCTGCAGATTGCCAAGGAGAAAGAGGCGTCGGGCGAGCCGCTGT
CATGGGCGGACACGCGGCGGATGAAGATGACGAGCCGGGTCATCCAGGAGACGATGAGGG
TGGCGTCCATCCTCTCCTTCACCTTCAGGGAGGCCGTGGAGGACGTGGAATACCAAGGGT
ACCTGATCCCCAAGGGCTGGAAAGTGCTACCTCTGTTCCGCAACATCCACCACAACCCCG
ACCACTTCCCCTGCCCGGAAAAGTTCGACCCGTCCCGGTTCGAGGTCAGCATCACGAACC
CACTCTTCCGTGTTTTTGTTCCCTTCCCTCCCTTTCCTTTCCCGGTGCGGCCGACTTCCT
AGCCAAGTCGGTCCGCGGTTTGCGAGCAGTGGCCGGTATGGGTTTTCCTGACCCCGCGTC
CGTCCCGTCACTGTTGCAGGTGGCGCCCAAGCCCAACACGTTCATGCCGTTCGGGAACGG
GACCCACTCGTGCCCGGGCAACGAGCTCGCCAAGCTGGAGATGCTCGTGCTCTTCCACCA
CCTCGCAACCAAGTACAGGTGGTCCACGTCCAAGTCCGAGAGCGGCGTCCAGTTCGGCCC
CTTCGCGCTGCCGCTCAACGGCCTCCCCATGAGCTTCACCCGCAAGAACACCGAGCAGGA
GTGAAAACCGAACAGGGAGACAAAAAGAAGAAGAAGAATACTAGCATCAGCTAAGCTGGG
GAAAGCTGGCAAAACCAACATCAACGGCGGGCAGCGGCGCCACGCAGCGCGCGCGAGTCC
ATTTTCGCGGCGGTCACCGTCCGGGGGGACACCTGTTGGCGCCGCAGTGGGAGCGGGAGA
CCGAACGGTGGATTCCGTATTAGCACGGATCATCAGAGTCCTTGTACAGATTCTTCAGCT
AGGACCACGGTTGGCAATCGAGAGGAGGAGCAGAGGAGTTGATGAAAAAAACCAAACACT
ACGTAGACATCTGAGCTAGGGAGCGCCACAAAGAAGTGGCCCTTAATTGTAAAACCAACC
ATTTTTTATCCTTTTTTGCTTAGTTTTTTTTTTGGCCAACAACTATAGGAGAAGAGTAGA
GAAGAGAAGAGAAATTGGGGAGAAAATACAGGGAGGATGAAGAGGCCCTGATTGGGATGT
AAGCTAGGTTGCCCGCCTGAAAGCAGGCTGGCATGCAGATGCAGCTATAGGTCGAATAAT
CGAGGCGAGCGATGATGGACGGATGGATCGATTCATCGATCGCCAGAGTCAAAAGGGAAG
AACGTCGTGATCCCCCGCGGGCTAAGCCAGGCCACGGGAGAGCGACTCCTCTGTACCGTT
TCGTCCAACTCAAGAGAAAATGACCTTCTTG

CDS

1269 bp

>Os02t0703600-01 Similar to Abscisic acid 8'-hydroxylase 1.
ATGGGTGCTTTTCTTCTGTTCGTGTGCGTGCTCGCGCCTTTCTTGCTTGTCTGCGCCGTC
CGCGGCCGCCGCCGGCAGGCGGGCTCGTCGGAAGCGGCGGCGTGCGGCCTGCCGCTGCCG
CCGGGGTCGATGGGGTGGCCGTACGTCGGGGAGACGTTCCAGCTGTACTCGTCCAAGAAC
CCCAACGTGTTCTTCAACAAGAAGCGGAACAAGTACGGTCCCATCTTCAAGACGCACATC
CTGGGATGCCCCTGCGTGATGGTGTCCAGCCCGGAGGCGGCGCGGTTCGTGCTGGTGACG
CAGGCGCACCTCTTCAAGCCCACCTTCCCGGCGAGCAAGGAGCGGATGCTGGGTCCCCAG
GCCATCTTCTTCCAGCAGGGCGACTACCACGCCCACCTCCGCCGCATCGTCTCCCGCGCC
TTCTCCCCCGAGTCCATCCGCGCCTCCGTCCCGGCCATCGAGGCCATCGCGCTCCGCTCC
CTCCACTCCTGGGACGGCCAGTTCGTCAACACCTTCCAAGAGATGAAGACTTACGCGCTG
AATGTGGCATTGCTGTCCATCTTCGGGGAGGAGGAGATGCGCTACATCGAGGAGCTGAAG
CAGTGCTACCTGACGCTGGAGAAGGGGTACAACtcgatgccggtgaacctgccgggcacc
ctgttccacaaggccatgaaggcccggaagaggctgggcgccattgtggcccacatcatc
tctgcccggcgcgagcggcagcgggggaacgacctgctagggtcgttcgtggacggccgc
gaggccctcaccgacgcccagatcgccgacaacgtcatcggcgtcatcttcgccgcccgc
gacaccaccgccagcgtcctcacctggatggtcaagttcctcggcgaccaccccgccgtc
ctcaagGCCGTCACCGAAGAGCAGCTGCAGATTGCCAAGGAGAAAGAGGCGTCGGGCGAG
CCGCTGTCATGGGCGGACACGCGGCGGATGAAGATGACGAGCCGGGTCATCCAGGAGACG
ATGAGGGTGGCGTCCATCCTCTCCTTCACCTTCAGGGAGGCCGTGGAGGACGTGGAATAC
CAAGGGTACCTGATCCCCAAGGGCTGGAAAGTGCTACCTCTGTTCCGCAACATCCACCAC
AACCCCGACCACTTCCCCTGCCCGGAAAAGTTCGACCCGTCCCGGTTCGAGGTCAGCATC
ACGAACCCACTCTTCCGTGTTTTTGTTCCCTTCCCTCCCTTTCCTTTCCCGGTGCGGCCG
ACTTCCTAG

Protein

423 aa

>Os02t0703600-01 Similar to Abscisic acid 8'-hydroxylase 1.
MGAFLLFVCVLAPFLLVCAVRGRRRQAGSSEAAACGLPLPPGSMGWPYVGETFQLYSSKN
PNVFFNKKRNKYGPIFKTHILGCPCVMVSSPEAARFVLVTQAHLFKPTFPASKERMLGPQ
AIFFQQGDYHAHLRRIVSRAFSPESIRASVPAIEAIALRSLHSWDGQFVNTFQEMKTYAL
NVALLSIFGEEEMRYIEELKQCYLTLEKGYNSMPVNLPGTLFHKAMKARKRLGAIVAHII
SARRERQRGNDLLGSFVDGREALTDAQIADNVIGVIFAARDTTASVLTWMVKFLGDHPAV
LKAVTEEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVEDVEY
QGYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFEVSITNPLFRVFVPFPPFPFPVRP
TS*

5'UTR

chr02:28995717..28995829 (+ strand) : 113 bp

CDS

chr02:28995830..28996360 (+ strand) : 531 bp

chr02:28996465..28996848 (+ strand) : 384 bp

chr02:28996929..28997097 (+ strand) : 169 bp

chr02:28997279..28997463 (+ strand) : 185 bp

3'UTR

chr02:28997464..28998452 (+ strand) : 989 bp

FASTA

>Os02t0703600-01 class=Sequence position=chr02:28995717..28998452 (+ strand)
TCCACACCCC CCCCAACAAC ACCACCGCCC ATTTCCCTTT CTCTTCCTCT TCTTCTTCCT TCTCCTCCTA CTCCTCTGCG
ATTGACAAAG ATAAGTGAAG TGAGCAGGCG CCAATGGGTG CTTTTCTTCT GTTCGTGTGC GTGCTCGCGC CTTTCTTGCT
TGTCTGCGCC GTCCGCGGCC GCCGCCGGCA GGCGGGCTCG TCGGAAGCGG CGGCGTGCGG CCTGCCGCTG CCGCCGGGGT
CGATGGGGTG GCCGTACGTC GGGGAGACGT TCCAGCTGTA CTCGTCCAAG AACCCCAACG TGTTCTTCAA CAAGAAGCGG
AACAAGTACG GTCCCATCTT CAAGACGCAC ATCCTGGGAT GCCCCTGCGT GATGGTGTCC AGCCCGGAGG CGGCGCGGTT
CGTGCTGGTG ACGCAGGCGC ACCTCTTCAA GCCCACCTTC CCGGCGAGCA AGGAGCGGAT GCTGGGTCCC CAGGCCATCT
TCTTCCAGCA GGGCGACTAC CACGCCCACC TCCGCCGCAT CGTCTCCCGC GCCTTCTCCC CCGAGTCCAT CCGCGCCTCC
GTCCCGGCCA TCGAGGCCAT CGCGCTCCGC TCCCTCCACT CCTGGGACGG CCAGTTCGTC AACACCTTCC AAGAGATGAA
GACTGTGAGT TCTTACTGCC TAACTCCTCT TCCCACTCTG CTTTGCTCTG CTCTACTCTG CTTTGCTGAT CGATCCGATG
TGTTTGTTGT TGATGGCATA TACAACAGTA CGCGCTGAAT GTGGCATTGC TGTCCATCTT CGGGGAGGAG GAGATGCGCT
ACATCGAGGA GCTGAAGCAG TGCTACCTGA CGCTGGAGAA GGGGTACAAC tcgatgccgg tgaacctgcc gggcaccctg
ttccacaagg ccatgaaggc ccggaagagg ctgggcgcca ttgtggccca catcatctct gcccggcgcg agcggcagcg
ggggaacgac ctgctagggt cgttcgtgga cggccgcgag gccctcaccg acgcccagat cgccgacaac gtcatcggcg
tcatcttcgc cgcccgcgac accaccgcca gcgtcctcac ctggatggtc aagttcctcg gcgaccaccc cgccgtcctc
aagGCCGTCA CCGTAAGTTC GCCTCCTCAT ATCTCATAGT ATATCAAAGT CCTTGATGGT GAGGCTGACC GCGGGTGCCA
TGGATGGAAC AGGAAGAGCA GCTGCAGATT GCCAAGGAGA AAGAGGCGTC GGGCGAGCCG CTGTCATGGG CGGACACGCG
GCGGATGAAG ATGACGAGCC GGGTCATCCA GGAGACGATG AGGGTGGCGT CCATCCTCTC CTTCACCTTC AGGGAGGCCG
TGGAGGACGT GGAATACCAA GGTGAGCAGC AGAGCAGAGC TGTCCGGTGG CAGCCTGTCC GTCCCTTTCG AGACAGCCTC
GCGCTTCTCT TCCGCTGCGA GTGAACTGGA CCGAATGGGG CAGACTGGTT CCTTAACTGA AATAGACTAA CTCGATCAGT
CGTCCCAGAA TCTAACCTCG TTCGATCGTC TGCTCTGTGC AGGGTACCTG ATCCCCAAGG GCTGGAAAGT GCTACCTCTG
TTCCGCAACA TCCACCACAA CCCCGACCAC TTCCCCTGCC CGGAAAAGTT CGACCCGTCC CGGTTCGAGG TCAGCATCAC
GAACCCACTC TTCCGTGTTT TTGTTCCCTT CCCTCCCTTT CCTTTCCCGG TGCGGCCGAC TTCCTAGCCA AGTCGGTCCG
CGGTTTGCGA GCAGTGGCCG GTATGGGTTT TCCTGACCCC GCGTCCGTCC CGTCACTGTT GCAGGTGGCG CCCAAGCCCA
ACACGTTCAT GCCGTTCGGG AACGGGACCC ACTCGTGCCC GGGCAACGAG CTCGCCAAGC TGGAGATGCT CGTGCTCTTC
CACCACCTCG CAACCAAGTA CAGGTGGTCC ACGTCCAAGT CCGAGAGCGG CGTCCAGTTC GGCCCCTTCG CGCTGCCGCT
CAACGGCCTC CCCATGAGCT TCACCCGCAA GAACACCGAG CAGGAGTGAA AACCGAACAG GGAGACAAAA AGAAGAAGAA
GAATACTAGC ATCAGCTAAG CTGGGGAAAG CTGGCAAAAC CAACATCAAC GGCGGGCAGC GGCGCCACGC AGCGCGCGCG
AGTCCATTTT CGCGGCGGTC ACCGTCCGGG GGGACACCTG TTGGCGCCGC AGTGGGAGCG GGAGACCGAA CGGTGGATTC
CGTATTAGCA CGGATCATCA GAGTCCTTGT ACAGATTCTT CAGCTAGGAC CACGGTTGGC AATCGAGAGG AGGAGCAGAG
GAGTTGATGA AAAAAACCAA ACACTACGTA GACATCTGAG CTAGGGAGCG CCACAAAGAA GTGGCCCTTA ATTGTAAAAC
CAACCATTTT TTATCCTTTT TTGCTTAGTT TTTTTTTTGG CCAACAACTA TAGGAGAAGA GTAGAGAAGA GAAGAGAAAT
TGGGGAGAAA ATACAGGGAG GATGAAGAGG CCCTGATTGG GATGTAAGCT AGGTTGCCCG CCTGAAAGCA GGCTGGCATG
CAGATGCAGC TATAGGTCGA ATAATCGAGG CGAGCGATGA TGGACGGATG GATCGATTCA TCGATCGCCA GAGTCAAAAG
GGAAGAACGT CGTGATCCCC CGCGGGCTAA GCCAGGCCAC GGGAGAGCGA CTCCTCTGTA CCGTTTCGTC CAACTCAAGA
GAAAATGACC TTCTTG