Os02t0703600-02

Locus

Os02g0703600

Description

ABA 8'-hydroxylase, Response to submergence

RAP-DB Gene Symbol Synonym(s)

OsABA8ox1, CYP707A5

RAP-DB Gene Name Synonym(s)

ABA 8'-hydroxylase 1

CGSNL Gene Symbol

ABA8OX1

CGSNL Gene Name

ABA-8'-HYDROXYLASE 1

Oryzabase Gene Symbol Synonym(s)

OsABA8OX1, CYP707A5, OsCYP707A5, ABA8ox1, OsABA8ox1, OsABA8'OH1, ABA8'OH1

Oryzabase Gene Name Synonym(s)

Abscisic acid 8'-hydroxylase 1, ABA 8'-hydroxylase 1 ; Cytochrome P450 707A5, ABA 8'-hydroxylase1

Transcript Evidence

AB277270

Protein Evidence

Q05JG2

Literature

PMID: 17205969

Note

Manual Curation

October 15, 2020

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 superfamily (IPR036396)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Others

Oryzabase (7251)

Transcript

1678 bp

>Os02t0703600-02 ABA 8'-hydroxylase, Response to submergence
CCTTTCTCTTCCTCTTCTTCTTCCTTCTCCTCCTACTCCTCTGCGATTGACAAAGATAAG
TGAAGTGAGCAGGCGCCAATGGGTGCTTTTCTTCTGTTCGTGTGCGTGCTCGCGCCTTTC
TTGCTTGTCTGCGCCGTCCGCGGCCGCCGCCGGCAGGCGGGCTCGTCGGAAGCGGCGGCG
TGCGGCCTGCCGCTGCCGCCGGGGTCGATGGGGTGGCCGTACGTCGGGGAGACGTTCCAG
CTGTACTCGTCCAAGAACCCCAACGTGTTCTTCAACAAGAAGCGGAACAAGTACGGTCCC
ATCTTCAAGACGCACATCCTGGGATGCCCCTGCGTGATGGTGTCCAGCCCGGAGGCGGCG
CGGTTCGTGCTGGTGACGCAGGCGCACCTCTTCAAGCCCACCTTCCCGGCGAGCAAGGAG
CGGATGCTGGGTCCCCAGGCCATCTTCTTCCAGCAGGGCGACTACCACGCCCACCTCCGC
CGCATCGTCTCCCGCGCCTTCTCCCCCGAGTCCATCCGCGCCTCCGTCCCGGCCATCGAG
GCCATCGCGCTCCGCTCCCTCCACTCCTGGGACGGCCAGTTCGTCAACACCTTCCAAGAG
ATGAAGACTTACGCGCTGAATGTGGCATTGCTGTCCATCTTCGGGGAGGAGGAGATGCGC
TACATCGAGGAGCTGAAGCAGTGCTACCTGACGCTGGAGAAGGGGTACAACtcgatgccg
gtgaacctgccgggcaccctgttccacaaggccatgaaggcccggaagaggctgggcgcc
attgtggcccacatcatctctgcccggcgcgagcggcagcgggggaacgacctgctaggg
tcgttcgtggacggccgcgaggccctcaccgacgcccagatcgccgacaacgtcatcggc
gtcatcttcgccgcccgcgacaccaccgccagcgtcctcacctggatggtcaagttcctc
ggcgaccaccccgccgtcctcaagGCCGTCACCGAAGAGCAGCTGCAGATTGCCAAGGAG
AAAGAGGCGTCGGGCGAGCCGCTGTCATGGGCGGACACGCGGCGGATGAAGATGACGAGC
CGGGTCATCCAGGAGACGATGAGGGTGGCGTCCATCCTCTCCTTCACCTTCAGGGAGGCC
GTGGAGGACGTGGAATACCAAGGGTACCTGATCCCCAAGGGCTGGAAAGTGCTACCTCTG
TTCCGCAACATCCACCACAACCCCGACCACTTCCCCTGCCCGGAAAAGTTCGACCCGTCC
CGGTTCGAGGTGGCGCCCAAGCCCAACACGTTCATGCCGTTCGGGAACGGGACCCACTCG
TGCCCGGGCAACGAGCTCGCCAAGCTGGAGATGCTCGTGCTCTTCCACCACCTCGCAACC
AAGTACAGGTGGTCCACGTCCAAGTCCGAGAGCGGCGTCCAGTTCGGCCCCTTCGCGCTG
CCGCTCAACGGCCTCCCCATGAGCTTCACCCGCAAGAACACCGAGCAGGAGTGAAAACCG
AACAGGGAGACAAAAAGAAGAAGAAGAATACTAGCATCAGCTAAGCTGGGGAAAGCTGGC
AAAACCAACATCAACGGCGGGCAGCGGCGCCACGCAGCGCGCGCGAGTCCATTTTCGCGG
CGGTCACCGTCCGGGGGGACACCTGTTGGCGCCGCAGTGGGAGCGGGAGACCGAACGG

CDS

1416 bp

>Os02t0703600-02 ABA 8'-hydroxylase, Response to submergence
ATGGGTGCTTTTCTTCTGTTCGTGTGCGTGCTCGCGCCTTTCTTGCTTGTCTGCGCCGTC
CGCGGCCGCCGCCGGCAGGCGGGCTCGTCGGAAGCGGCGGCGTGCGGCCTGCCGCTGCCG
CCGGGGTCGATGGGGTGGCCGTACGTCGGGGAGACGTTCCAGCTGTACTCGTCCAAGAAC
CCCAACGTGTTCTTCAACAAGAAGCGGAACAAGTACGGTCCCATCTTCAAGACGCACATC
CTGGGATGCCCCTGCGTGATGGTGTCCAGCCCGGAGGCGGCGCGGTTCGTGCTGGTGACG
CAGGCGCACCTCTTCAAGCCCACCTTCCCGGCGAGCAAGGAGCGGATGCTGGGTCCCCAG
GCCATCTTCTTCCAGCAGGGCGACTACCACGCCCACCTCCGCCGCATCGTCTCCCGCGCC
TTCTCCCCCGAGTCCATCCGCGCCTCCGTCCCGGCCATCGAGGCCATCGCGCTCCGCTCC
CTCCACTCCTGGGACGGCCAGTTCGTCAACACCTTCCAAGAGATGAAGACTTACGCGCTG
AATGTGGCATTGCTGTCCATCTTCGGGGAGGAGGAGATGCGCTACATCGAGGAGCTGAAG
CAGTGCTACCTGACGCTGGAGAAGGGGTACAACtcgatgccggtgaacctgccgggcacc
ctgttccacaaggccatgaaggcccggaagaggctgggcgccattgtggcccacatcatc
tctgcccggcgcgagcggcagcgggggaacgacctgctagggtcgttcgtggacggccgc
gaggccctcaccgacgcccagatcgccgacaacgtcatcggcgtcatcttcgccgcccgc
gacaccaccgccagcgtcctcacctggatggtcaagttcctcggcgaccaccccgccgtc
ctcaagGCCGTCACCGAAGAGCAGCTGCAGATTGCCAAGGAGAAAGAGGCGTCGGGCGAG
CCGCTGTCATGGGCGGACACGCGGCGGATGAAGATGACGAGCCGGGTCATCCAGGAGACG
ATGAGGGTGGCGTCCATCCTCTCCTTCACCTTCAGGGAGGCCGTGGAGGACGTGGAATAC
CAAGGGTACCTGATCCCCAAGGGCTGGAAAGTGCTACCTCTGTTCCGCAACATCCACCAC
AACCCCGACCACTTCCCCTGCCCGGAAAAGTTCGACCCGTCCCGGTTCGAGGTGGCGCCC
AAGCCCAACACGTTCATGCCGTTCGGGAACGGGACCCACTCGTGCCCGGGCAACGAGCTC
GCCAAGCTGGAGATGCTCGTGCTCTTCCACCACCTCGCAACCAAGTACAGGTGGTCCACG
TCCAAGTCCGAGAGCGGCGTCCAGTTCGGCCCCTTCGCGCTGCCGCTCAACGGCCTCCCC
ATGAGCTTCACCCGCAAGAACACCGAGCAGGAGTGA

Protein

472 aa

>Os02t0703600-02 ABA 8'-hydroxylase, Response to submergence
MGAFLLFVCVLAPFLLVCAVRGRRRQAGSSEAAACGLPLPPGSMGWPYVGETFQLYSSKN
PNVFFNKKRNKYGPIFKTHILGCPCVMVSSPEAARFVLVTQAHLFKPTFPASKERMLGPQ
AIFFQQGDYHAHLRRIVSRAFSPESIRASVPAIEAIALRSLHSWDGQFVNTFQEMKTYAL
NVALLSIFGEEEMRYIEELKQCYLTLEKGYNSMPVNLPGTLFHKAMKARKRLGAIVAHII
SARRERQRGNDLLGSFVDGREALTDAQIADNVIGVIFAARDTTASVLTWMVKFLGDHPAV
LKAVTEEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVEDVEY
QGYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFEVAPKPNTFMPFGNGTHSCPGNEL
AKLEMLVLFHHLATKYRWSTSKSESGVQFGPFALPLNGLPMSFTRKNTEQE*

5'UTR

chr02:28995752..28995829 (+ strand) : 78 bp

CDS

chr02:28995830..28996360 (+ strand) : 531 bp

chr02:28996465..28996848 (+ strand) : 384 bp

chr02:28996929..28997097 (+ strand) : 169 bp

chr02:28997279..28997385 (+ strand) : 107 bp

chr02:28997541..28997765 (+ strand) : 225 bp

3'UTR

chr02:28997766..28997949 (+ strand) : 184 bp

FASTA

>Os02t0703600-02 class=Sequence position=chr02:28995752..28997949 (+ strand)
CCTTTCTCTT CCTCTTCTTC TTCCTTCTCC TCCTACTCCT CTGCGATTGA CAAAGATAAG TGAAGTGAGC AGGCGCCAAT
GGGTGCTTTT CTTCTGTTCG TGTGCGTGCT CGCGCCTTTC TTGCTTGTCT GCGCCGTCCG CGGCCGCCGC CGGCAGGCGG
GCTCGTCGGA AGCGGCGGCG TGCGGCCTGC CGCTGCCGCC GGGGTCGATG GGGTGGCCGT ACGTCGGGGA GACGTTCCAG
CTGTACTCGT CCAAGAACCC CAACGTGTTC TTCAACAAGA AGCGGAACAA GTACGGTCCC ATCTTCAAGA CGCACATCCT
GGGATGCCCC TGCGTGATGG TGTCCAGCCC GGAGGCGGCG CGGTTCGTGC TGGTGACGCA GGCGCACCTC TTCAAGCCCA
CCTTCCCGGC GAGCAAGGAG CGGATGCTGG GTCCCCAGGC CATCTTCTTC CAGCAGGGCG ACTACCACGC CCACCTCCGC
CGCATCGTCT CCCGCGCCTT CTCCCCCGAG TCCATCCGCG CCTCCGTCCC GGCCATCGAG GCCATCGCGC TCCGCTCCCT
CCACTCCTGG GACGGCCAGT TCGTCAACAC CTTCCAAGAG ATGAAGACTG TGAGTTCTTA CTGCCTAACT CCTCTTCCCA
CTCTGCTTTG CTCTGCTCTA CTCTGCTTTG CTGATCGATC CGATGTGTTT GTTGTTGATG GCATATACAA CAGTACGCGC
TGAATGTGGC ATTGCTGTCC ATCTTCGGGG AGGAGGAGAT GCGCTACATC GAGGAGCTGA AGCAGTGCTA CCTGACGCTG
GAGAAGGGGT ACAACtcgat gccggtgaac ctgccgggca ccctgttcca caaggccatg aaggcccgga agaggctggg
cgccattgtg gcccacatca tctctgcccg gcgcgagcgg cagcggggga acgacctgct agggtcgttc gtggacggcc
gcgaggccct caccgacgcc cagatcgccg acaacgtcat cggcgtcatc ttcgccgccc gcgacaccac cgccagcgtc
ctcacctgga tggtcaagtt cctcggcgac caccccgccg tcctcaagGC CGTCACCGTA AGTTCGCCTC CTCATATCTC
ATAGTATATC AAAGTCCTTG ATGGTGAGGC TGACCGCGGG TGCCATGGAT GGAACAGGAA GAGCAGCTGC AGATTGCCAA
GGAGAAAGAG GCGTCGGGCG AGCCGCTGTC ATGGGCGGAC ACGCGGCGGA TGAAGATGAC GAGCCGGGTC ATCCAGGAGA
CGATGAGGGT GGCGTCCATC CTCTCCTTCA CCTTCAGGGA GGCCGTGGAG GACGTGGAAT ACCAAGGTGA GCAGCAGAGC
AGAGCTGTCC GGTGGCAGCC TGTCCGTCCC TTTCGAGACA GCCTCGCGCT TCTCTTCCGC TGCGAGTGAA CTGGACCGAA
TGGGGCAGAC TGGTTCCTTA ACTGAAATAG ACTAACTCGA TCAGTCGTCC CAGAATCTAA CCTCGTTCGA TCGTCTGCTC
TGTGCAGGGT ACCTGATCCC CAAGGGCTGG AAAGTGCTAC CTCTGTTCCG CAACATCCAC CACAACCCCG ACCACTTCCC
CTGCCCGGAA AAGTTCGACC CGTCCCGGTT CGAGGTCAGC ATCACGAACC CACTCTTCCG TGTTTTTGTT CCCTTCCCTC
CCTTTCCTTT CCCGGTGCGG CCGACTTCCT AGCCAAGTCG GTCCGCGGTT TGCGAGCAGT GGCCGGTATG GGTTTTCCTG
ACCCCGCGTC CGTCCCGTCA CTGTTGCAGG TGGCGCCCAA GCCCAACACG TTCATGCCGT TCGGGAACGG GACCCACTCG
TGCCCGGGCA ACGAGCTCGC CAAGCTGGAG ATGCTCGTGC TCTTCCACCA CCTCGCAACC AAGTACAGGT GGTCCACGTC
CAAGTCCGAG AGCGGCGTCC AGTTCGGCCC CTTCGCGCTG CCGCTCAACG GCCTCCCCAT GAGCTTCACC CGCAAGAACA
CCGAGCAGGA GTGAAAACCG AACAGGGAGA CAAAAAGAAG AAGAAGAATA CTAGCATCAG CTAAGCTGGG GAAAGCTGGC
AAAACCAACA TCAACGGCGG GCAGCGGCGC CACGCAGCGC GCGCGAGTCC ATTTTCGCGG CGGTCACCGT CCGGGGGGAC
ACCTGTTGGC GCCGCAGTGG GAGCGGGAGA CCGAACGG

Locus: Os02g0703600

Loading...

Locus: Os02g0703600

Loading...