Os02t0707200-01

Locus

Os02g0707200

Description

Transcription factor, Modulation of sugar transport

RAP-DB Gene Symbol Synonym(s)

OsDOF11

RAP-DB Gene Name Synonym(s)

DNA BINDING WITH ONE FINGER 11

CGSNL Gene Symbol

DOF7

CGSNL Gene Name

DNA BINDING WITH ONE FINGER 7

Oryzabase Gene Symbol Synonym(s)

OsDof7, Dof7, OsDof-7, OsDOF11, DOF11

Oryzabase Gene Name Synonym(s)

DNA BINDING WITH ONE FINGER 11

Transcript Evidence

Inferred from literature

Protein Evidence

B9GCY5

Literature

PMID: 29656028

Note

Manual Curation

April 7, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Zinc finger, Dof-type (IPR003851)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os02t0707200-00)

Others

Oryzabase (8798)

Transcript

1815 bp

>Os02t0707200-01 Transcription factor, Modulation of sugar transport
GGACGGACGAGCAGTGAACTGGTGGTCTCTCTCTCCATCTCTCTCTTCCGCCTTTGGCCA
TGCAGCTTTCCCTCCCCTTCTTATTCACATCTCCCTCGTTCACATCTCCCACCACCACCA
CCGAGTCGATCACCAACAACCCCCACACCACATCGACTGATTAGCTAGTTAGCTCCTCTT
CTCTTCCCCTCCTACCTCCACTCCTACTCCATTATCCAGCAGTTCGATCGATCCATGGCT
ATCTAGCTTCTGATCTTGATCCCTTTCTTCTTCTCATCGTCCTTGTTTGTTCTTATTCCT
AGCTACTTAGCTAGATCTATCGATCAGTTCAGACCTCTTAATTCCTGTCCTGATCAATCA
CGTTCTGTCTGTATCCTTTGATTCGTCGACAATCCTAGTACTTCATGGAGCAGTGTTAGT
TAGCTAGCAAAAGTAGTACTTTCATCAGGAGTGTCTATCGGCAAATAGCTAGGTTTTCTG
GCTTAACACGTACTTTCATTAATTTGGAAGAACAGCAAGACAAAGAAACTGATTAAGATC
AGCGAGTAATCGATGATGGCAGGAGCTCCCCCGATGCATATCTGCATGGACTCCGACTGG
CTCAAGGGCATCGTCCCCGAGGAGCACGGGATGGGGTCGTCGTCGCCGTCGGCggagctg
atcgcgtgcccgcgggcgccgatgcaggcggcggcggcggcggccgaccgccggcttcgc
ccccagcacgaccagccgctcaagtgcccgcgGTGCGAGTCGACGCACACCAAGTTCTGC
TACTACAATAACTACAGCCTCTCGCAGCCGCGCTACTTCTGCAAGACGTGCCGCCGCTAC
TGGACCAAGGGCGGCTCGCTCCGGAACGTCCCCGTCGGCGGCGGCTGCCGCAAGAACAAG
CGCGCGCCGCCCAAGAAGGCCGCCGCCCACGCCCAGCCCGCGGTGGCGGTGGCGGCGGCG
CTGCAAGGCCGCCACATGGAGACCGGACTCCACCTGTCCTTCTCCGGGATGCAGCATCAT
CTTGCGCCGCCGCCGCCGGCGGCGGCCACCGCGGCCGACCCGCTCTGCAGCCTTGGACTA
TTTGACTGGAAGCAGTACGACCCCGTCTTCGCCGGCTCCGGTGGCGGCGGCTCCCCCGTG
GCGGCGCTGGAGAGCGCTGGTGGCTCGGAGGCGCAGTTCATGGGTGCTGGCATGATGGGC
ATTGGCGGCGGCGGCGTCGCGGAGTACCATGCGCTGAGCGCGCTCCGGTTCGCGGCAGGG
CTCGGCGATCACCTGGCGCTGCCGTTCGGCGCGGTGCGGGCGGAGCACGACGCCGTCGAG
GTGAAGCCGGTGGCGGCGGAGAGGCTGCTGTCGCTCGAGTGGTGCGGCGAGGCGAGCCGC
ACGGCGGCGCCGGAGAGCTCCATTAGCTCGCTGGGCGGGCTGGGACTGTGGAGCGGCATG
ATCGGCGGCGGGCACCATCACCATGGCTCCTCCGCTGCCATCTGAGGCGAAGCAAGCTAG
CATGCATGCAATGCGAAGGACACGTGATCGAACGCCGCGAGCCGCTGCAATCTGTGCAAG
AAGGAAAGGATTAGCGGTTTGCTAATAGCATTAACAAAGTATGACTACGTAGAATTGTTT
GGCTTTAATTTCTTTGCTGCTGTTTTCCATCTTCTCATGCATGGTAATCTCCTACTTATT
TTCGTCGTTTTGTCTTTGTATTTCCCAACTATTCCAAGTCCTGGTGATGTTCTGCTGTTG
TTCCAGCTCATGCATATTGTCGTGCATGGTTCTGTTAAACACGATGCTGGCTTGCTAGAG
ATTATAAGTTTGTTC

CDS

933 bp

>Os02t0707200-01 Transcription factor, Modulation of sugar transport
ATGATGGCAGGAGCTCCCCCGATGCATATCTGCATGGACTCCGACTGGCTCAAGGGCATC
GTCCCCGAGGAGCACGGGATGGGGTCGTCGTCGCCGTCGGCggagctgatcgcgtgcccg
cgggcgccgatgcaggcggcggcggcggcggccgaccgccggcttcgcccccagcacgac
cagccgctcaagtgcccgcgGTGCGAGTCGACGCACACCAAGTTCTGCTACTACAATAAC
TACAGCCTCTCGCAGCCGCGCTACTTCTGCAAGACGTGCCGCCGCTACTGGACCAAGGGC
GGCTCGCTCCGGAACGTCCCCGTCGGCGGCGGCTGCCGCAAGAACAAGCGCGCGCCGCCC
AAGAAGGCCGCCGCCCACGCCCAGCCCGCGGTGGCGGTGGCGGCGGCGCTGCAAGGCCGC
CACATGGAGACCGGACTCCACCTGTCCTTCTCCGGGATGCAGCATCATCTTGCGCCGCCG
CCGCCGGCGGCGGCCACCGCGGCCGACCCGCTCTGCAGCCTTGGACTATTTGACTGGAAG
CAGTACGACCCCGTCTTCGCCGGCTCCGGTGGCGGCGGCTCCCCCGTGGCGGCGCTGGAG
AGCGCTGGTGGCTCGGAGGCGCAGTTCATGGGTGCTGGCATGATGGGCATTGGCGGCGGC
GGCGTCGCGGAGTACCATGCGCTGAGCGCGCTCCGGTTCGCGGCAGGGCTCGGCGATCAC
CTGGCGCTGCCGTTCGGCGCGGTGCGGGCGGAGCACGACGCCGTCGAGGTGAAGCCGGTG
GCGGCGGAGAGGCTGCTGTCGCTCGAGTGGTGCGGCGAGGCGAGCCGCACGGCGGCGCCG
GAGAGCTCCATTAGCTCGCTGGGCGGGCTGGGACTGTGGAGCGGCATGATCGGCGGCGGG
CACCATCACCATGGCTCCTCCGCTGCCATCTGA

Protein

310 aa

>Os02t0707200-01 Transcription factor, Modulation of sugar transport
MMAGAPPMHICMDSDWLKGIVPEEHGMGSSSPSAELIACPRAPMQAAAAAADRRLRPQHD
QPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAPP
KKAAAHAQPAVAVAAALQGRHMETGLHLSFSGMQHHLAPPPPAAATAADPLCSLGLFDWK
QYDPVFAGSGGGGSPVAALESAGGSEAQFMGAGMMGIGGGGVAEYHALSALRFAAGLGDH
LALPFGAVRAEHDAVEVKPVAAERLLSLEWCGEASRTAAPESSISSLGGLGLWSGMIGGG
HHHHGSSAAI*

5'UTR

chr02:29241211..29241762 (- strand) : 552 bp

CDS

chr02:29241157..29241210 (- strand) : 54 bp

chr02:29238394..29239272 (- strand) : 879 bp

3'UTR

chr02:29238064..29238393 (- strand) : 330 bp

FASTA

>Os02t0707200-01 class=Sequence position=chr02:29238064..29241762 (- strand)
GGACGGACGA GCAGTGAACT GGTGGTCTCT CTCTCCATCT CTCTCTTCCG CCTTTGGCCA TGCAGCTTTC CCTCCCCTTC
TTATTCACAT CTCCCTCGTT CACATCTCCC ACCACCACCA CCGAGTCGAT CACCAACAAC CCCCACACCA CATCGACTGA
TTAGCTAGTT AGCTCCTCTT CTCTTCCCCT CCTACCTCCA CTCCTACTCC ATTATCCAGC AGTTCGATCG ATCCATGGCT
ATCTAGCTTC TGATCTTGAT CCCTTTCTTC TTCTCATCGT CCTTGTTTGT TCTTATTCCT AGCTACTTAG CTAGATCTAT
CGATCAGTTC AGACCTCTTA ATTCCTGTCC TGATCAATCA CGTTCTGTCT GTATCCTTTG ATTCGTCGAC AATCCTAGTA
CTTCATGGAG CAGTGTTAGT TAGCTAGCAA AAGTAGTACT TTCATCAGGA GTGTCTATCG GCAAATAGCT AGGTTTTCTG
GCTTAACACG TACTTTCATT AATTTGGAAG AACAGCAAGA CAAAGAAACT GATTAAGATC AGCGAGTAAT CGATGATGGC
AGGAGCTCCC CCGATGCATA TCTGCATGGA CTCCGACTGG CTCAAGGTAC GCATGCATAT ATACCACGAT GATCTCGCAA
ACACTTAATT TTGCATCTGA TGCAATCTCG CGTGCATGTG CTAGAATAGC TAGCTGCAAA ATTCTTGTGC ATATGTATTT
ATTGGCTGCC TCTCCATGTC CTTAAAAAGA AAGGTTTAAT TGCATTTGCT TTCTGATCTT GTTAGGATTT TTACTTGCTC
GGATGCGTTG GTATGTTGCT GGTTAATTTG CAACGACGTA AATCCATATC CATGACCATG CATGCCTATA GCTATTCCGT
AGGAGAAAAA CTTTTAATTA ATTGATCAAA TGCTACTGTG TTAGATCGAT GCGCAGAACA GGAATTAAGA AAAAAAAAGG
AACCGATCAA GATTTAGATC TGCAGCGCTA ACTCCTAGCT CATTTGATAC AGATGATTAA CTAGGCTGAT CTTTAAGCAT
ACCCCAATAT TCCATTTGAA TTTTGATAAA TCGATCATAA TACAAAACTT GTGAAAAATT AACAGATTTC TGGTGTTATT
TTCTGTATAT ATGAAGGGCA CGGTATATGG AATTAAACAT CTTGTAAAAA ATGGCTGTTT CGATCAGGGT AGCTAACTTT
GTTCATTCGT TCCACACGTG TTGTTTGACT GTTTTATATC CGTTGTTTTA ACGAATTATA TTTACTCGAC GGCCTTGTTT
TGTGTTTCCA TTCCTTTTCT TTTGTTCCAC AAAGATGATA CAACCAATCT GGCATCTTTT CCCTTGAGTT AAAACTTAAA
ACACTGTTGG CTGTCAATTC AATTTTGTTG CTTAATTTAA TTTGGAACAC TTCATGATCA ATCTATGTAA TATGCAAATA
ATACTCTTGA ATATAAATGC GTCCATAGAT ACATCCATAA CAAATCTATT GCATGCATAA AACTCCAGAT GAAAAAAAAA
CTAGCAAAAT AATAGTGGAA AATCTAGAGT ATATGTGCCA ACTGACATTG ATATCCATTT CGAGAAACTG TGGAAAGTGT
CTGACCTGAA AGATTCTGGC ACTCTGCAAG CAAAAGCAAC AACATTGGCT AAAAGAGATT CAAACAAGTA CGGTTTGATC
ATATATGATC TGTTAAATTT TACTTTAACT TTAGAACATG GCTAAGCTAG CTTCATGCAT GACTGCATCG ATCTATTCAA
CAGCTATAAA TCCGAGGAAC AAACTAAACA GAAATAATAA GGTAGCATGC GCGAATGTAC AAGAAGAGAT CTATGTTAAT
CACTATTTAT TATAAACAGA GATTTAACTT TACCGTGCAA GGTCTATTAG TACTGTACAT AAGCACTGTT GCTGAAGAAC
TAATTTAATT AAGCTCAAAC GCATGCATGC TACTGTTGTT GGGAGTATCT CACCATGCAT CAAGTGTACA TGTATAAACC
ATATCAAATT CATGGAACAT GATTAAGAGA TCAAGACAAG TACATTTGGG CCCTATCATC AATGCAAAAA TAACATATAT
TTGTTGTAAC TTTAGCACGT GATGTAAAGA AGAACAGCAG GTAGCTAAAA CTACTAGCTG AGCAACAGAC CCAAGTGAGA
TCGATGCGAG TGCAAAAGTA CGGTCTCTGC CCTAGGATCG AGCCCAGATC TAAGCTTTAA TCCAAACTTG ATGCCTCCAT
CATAAGCTAT ATCCATCTTT GCAGTTTGTA CTTTGTGCTG GTCTTGTAGC TCACAGAGTG AGAAACCCTA GACATCATCC
ACCACCATGC ATTCATGCAT GGGACCAGCC CACGACGACG ACGAAACCCT TTCGCGCATT CCGAGGCTTC CATTCTCTCT
GTCAGACTTT GTCACCGCTG ATGATTACCG ATCACGTTCT CTGATGGATA GGTGACATGG TGTGGTGTGC TTGTTTTGCT
TTGCTTTCAG GGCATCGTCC CCGAGGAGCA CGGGATGGGG TCGTCGTCGC CGTCGGCgga gctgatcgcg tgcccgcggg
cgccgatgca ggcggcggcg gcggcggccg accgccggct tcgcccccag cacgaccagc cgctcaagtg cccgcgGTGC
GAGTCGACGC ACACCAAGTT CTGCTACTAC AATAACTACA GCCTCTCGCA GCCGCGCTAC TTCTGCAAGA CGTGCCGCCG
CTACTGGACC AAGGGCGGCT CGCTCCGGAA CGTCCCCGTC GGCGGCGGCT GCCGCAAGAA CAAGCGCGCG CCGCCCAAGA
AGGCCGCCGC CCACGCCCAG CCCGCGGTGG CGGTGGCGGC GGCGCTGCAA GGCCGCCACA TGGAGACCGG ACTCCACCTG
TCCTTCTCCG GGATGCAGCA TCATCTTGCG CCGCCGCCGC CGGCGGCGGC CACCGCGGCC GACCCGCTCT GCAGCCTTGG
ACTATTTGAC TGGAAGCAGT ACGACCCCGT CTTCGCCGGC TCCGGTGGCG GCGGCTCCCC CGTGGCGGCG CTGGAGAGCG
CTGGTGGCTC GGAGGCGCAG TTCATGGGTG CTGGCATGAT GGGCATTGGC GGCGGCGGCG TCGCGGAGTA CCATGCGCTG
AGCGCGCTCC GGTTCGCGGC AGGGCTCGGC GATCACCTGG CGCTGCCGTT CGGCGCGGTG CGGGCGGAGC ACGACGCCGT
CGAGGTGAAG CCGGTGGCGG CGGAGAGGCT GCTGTCGCTC GAGTGGTGCG GCGAGGCGAG CCGCACGGCG GCGCCGGAGA
GCTCCATTAG CTCGCTGGGC GGGCTGGGAC TGTGGAGCGG CATGATCGGC GGCGGGCACC ATCACCATGG CTCCTCCGCT
GCCATCTGAG GCGAAGCAAG CTAGCATGCA TGCAATGCGA AGGACACGTG ATCGAACGCC GCGAGCCGCT GCAATCTGTG
CAAGAAGGAA AGGATTAGCG GTTTGCTAAT AGCATTAACA AAGTATGACT ACGTAGAATT GTTTGGCTTT AATTTCTTTG
CTGCTGTTTT CCATCTTCTC ATGCATGGTA ATCTCCTACT TATTTTCGTC GTTTTGTCTT TGTATTTCCC AACTATTCCA
AGTCCTGGTG ATGTTCTGCT GTTGTTCCAG CTCATGCATA TTGTCGTGCA TGGTTCTGTT AAACACGATG CTGGCTTGCT
AGAGATTATA AGTTTGTTC

Locus: Os02g0707200

Loading...

Locus: Os02g0707200

Loading...