Os02t0708600-01

Locus

Os02g0708600

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET11, SDG706

Oryzabase Gene Name Synonym(s)

SET protein 11

Transcript Evidence

AK108743 (DDBJ, Best hit)

Protein Evidence

NP_001105206.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Functional domain (InterPro)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Zinc finger, C2H2 (IPR007087)

Pre-SET domain (IPR007728)

Zinc finger, C2H2-like (IPR015880)

Full-length cDNA

002-150-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0708600-01)

RiceXPro (AK108743)

Others

Oryzabase (13377)

KEGG (Os02t0708600-01)

Transcript

2056 bp

>Os02t0708600-01 SET domain containing protein.
CAAAAGAACAGAAAGGGCAAGTGATGAGCTCCTTTATGATAACCATAACCTTGGTAAGGA
TGATGGTTTACAGAAGTTCACCTGCAGATTATGTGGGATGATGTTTGATCTTTTGCCAGA
TCTTGGCCACCACCATCAAGTTGCTCATACAAACTCAGGTACAGTCAGTGATATCCCTTC
AGGACGTGAAAAGTATCAGTTTAACCGTGGTCGGCACTATTATTCAGCCTTCAAGAAAAG
TTTAAGACCATCCGGCTCATTGAAGAAGAGGACTAGTTCTGGAGTTGAGAAACATTTTAA
GGCTCAAAGCTTGGATCTATCTATGGATACATCACACATTGTGGAATCTGAGACCACCAC
CCTTGGTAGGTTACTGGATTTCCAATGCTCAGACGTGGCATTGACTTTATTTTCAAAGAT
TCAAAAGACAAGACCCCACCCAAGCAACCTTGATATTCTGTCTATTGCCCGTTCTGTTTG
CTGTAAGACAAGCCTTCGTGCTGCATTGAAAGCTAAATATGGAATCTTGCCTGATAACAT
ATTTGTGAAAGCTGCAAAGCTTTGTAGTGATGTTGGCATCCAAATTGATTGGCATCAAGA
AGAATTCTTTTGCCCTAAAGGTTGCAAGTCCAGGTCTAGTTCTAATTCCTTGCTCCCTTT
ACAGCCTACCCAAGTTGATTTTGTGATGAGTCCTCCAATTGGTGATGAGATATGGGGCAT
GGATGAATACCACTATGTTCTTGATTCAGAGCACTTTGGTTGGAATCTTAAGAATGAGAT
GGTTATTGTTTGTGAAGATGTTAGCTTTGGCAGGGAGAAAGTTCCAGTTGTCTGTGCCAT
TGATGTAGATGCAAAAGAATTTCCATATATGAAACCTGGAGAAATTTTGCAAAGTGAAAA
TTCTCTGCCCTGGCAAGGTTTCCACTACGTCACAAAGCGTTTGATGGATTCATCTCTTGT
TGATTCAGAGAACACTATGGTTGGGTGTGCTTGTTCTCATGCCCATTGCAGTCCTGAGGA
ATGTGATCATGTGAGCCTCTTTGATAGTATCTATGAGAACCTAGTGGATCTCCATGGTGT
ACCTATGCGTGGTAGATTTGCATATGATGAAAATAGCAAAGTTATTTTGCAGGAAGGATA
TCCTATATATGAGTGCAATTCATCATGCACTTGTGATGCCTCCTGTCAGAATAAAGTACT
GCAGAGAGGACTGCTGGTAAAGTTGGAAGTCTTCAGAACTGAGAATAAGGGTTGGGCTGT
TAGAGCCGCAGAACCTATTCCACAGGGCACATTTGTATGTGAGTACATTGGAGAGGTTTT
GAAGATGAAGGATGATGGGGCCATAAGACATGTAGAAAGGGAGGCAAAAAGTGGTAGCAG
CTACTTGTTTGAAATCACTTCTCAGATTGACAGGGAAAGAGTTCAGACTACAGGGACTAC
TGCATACGTGATTGATGCCACAAGATATGGCAACGTATCCCGTTTTATTAATCATAGCTG
TTCCCCAAATCTCAGTACGCGTTTAGTTTCGGTGGAGAGCAAAGACTGTCAGCTTGCGCA
CATTGGTTTGTTTGCAAACCAGGATATCTTGATGGGAGAAGAATTGGCCTATGACTATGG
ACAAAAATTGCTACCTGGTGATGGATGCCCCTGCCATTGTGGTGCTAAGAATTGCCGAGG
ACGTGTGTATTGAGTTTGCAGTGGGGCAGAAAATGGTAACGGAGCAGTCCAATCCTTAGC
ATATCTCCAGAAGTTCCTACAATGGCGTCACTTAGCAAGGGATAGCAATGTTTTTTTCTA
GAGCAACAATGCAGTGCTAGGATCTAATTCCCCATGCATCATTAGGAATCATCATATAGG
TCTCTCAACAGTTATTAGGCACACCATACGATTGATTTTAGTGTGGCACACTTATGCTTA
ACTGATCATTTGTTAGGAGCAACCTGAAATGAAAGCAGTTCAGGCTGCATTGTTCGTAGG
CCAGAAGTGAAGTGTCGTTGTAACATACCTTCATTCAATTTTTACTGCTCATAAGCGCCA
TCGTCGAAGTTGAACC

CDS

1692 bp

>Os02t0708600-01 SET domain containing protein.
AAAAGAACAGAAAGGGCAAGTGATGAGCTCCTTTATGATAACCATAACCTTGGTAAGGAT
GATGGTTTACAGAAGTTCACCTGCAGATTATGTGGGATGATGTTTGATCTTTTGCCAGAT
CTTGGCCACCACCATCAAGTTGCTCATACAAACTCAGGTACAGTCAGTGATATCCCTTCA
GGACGTGAAAAGTATCAGTTTAACCGTGGTCGGCACTATTATTCAGCCTTCAAGAAAAGT
TTAAGACCATCCGGCTCATTGAAGAAGAGGACTAGTTCTGGAGTTGAGAAACATTTTAAG
GCTCAAAGCTTGGATCTATCTATGGATACATCACACATTGTGGAATCTGAGACCACCACC
CTTGGTAGGTTACTGGATTTCCAATGCTCAGACGTGGCATTGACTTTATTTTCAAAGATT
CAAAAGACAAGACCCCACCCAAGCAACCTTGATATTCTGTCTATTGCCCGTTCTGTTTGC
TGTAAGACAAGCCTTCGTGCTGCATTGAAAGCTAAATATGGAATCTTGCCTGATAACATA
TTTGTGAAAGCTGCAAAGCTTTGTAGTGATGTTGGCATCCAAATTGATTGGCATCAAGAA
GAATTCTTTTGCCCTAAAGGTTGCAAGTCCAGGTCTAGTTCTAATTCCTTGCTCCCTTTA
CAGCCTACCCAAGTTGATTTTGTGATGAGTCCTCCAATTGGTGATGAGATATGGGGCATG
GATGAATACCACTATGTTCTTGATTCAGAGCACTTTGGTTGGAATCTTAAGAATGAGATG
GTTATTGTTTGTGAAGATGTTAGCTTTGGCAGGGAGAAAGTTCCAGTTGTCTGTGCCATT
GATGTAGATGCAAAAGAATTTCCATATATGAAACCTGGAGAAATTTTGCAAAGTGAAAAT
TCTCTGCCCTGGCAAGGTTTCCACTACGTCACAAAGCGTTTGATGGATTCATCTCTTGTT
GATTCAGAGAACACTATGGTTGGGTGTGCTTGTTCTCATGCCCATTGCAGTCCTGAGGAA
TGTGATCATGTGAGCCTCTTTGATAGTATCTATGAGAACCTAGTGGATCTCCATGGTGTA
CCTATGCGTGGTAGATTTGCATATGATGAAAATAGCAAAGTTATTTTGCAGGAAGGATAT
CCTATATATGAGTGCAATTCATCATGCACTTGTGATGCCTCCTGTCAGAATAAAGTACTG
CAGAGAGGACTGCTGGTAAAGTTGGAAGTCTTCAGAACTGAGAATAAGGGTTGGGCTGTT
AGAGCCGCAGAACCTATTCCACAGGGCACATTTGTATGTGAGTACATTGGAGAGGTTTTG
AAGATGAAGGATGATGGGGCCATAAGACATGTAGAAAGGGAGGCAAAAAGTGGTAGCAGC
TACTTGTTTGAAATCACTTCTCAGATTGACAGGGAAAGAGTTCAGACTACAGGGACTACT
GCATACGTGATTGATGCCACAAGATATGGCAACGTATCCCGTTTTATTAATCATAGCTGT
TCCCCAAATCTCAGTACGCGTTTAGTTTCGGTGGAGAGCAAAGACTGTCAGCTTGCGCAC
ATTGGTTTGTTTGCAAACCAGGATATCTTGATGGGAGAAGAATTGGCCTATGACTATGGA
CAAAAATTGCTACCTGGTGATGGATGCCCCTGCCATTGTGGTGCTAAGAATTGCCGAGGA
CGTGTGTATTGA

Protein

564 aa

>Os02t0708600-01 SET domain containing protein.
KRTERASDELLYDNHNLGKDDGLQKFTCRLCGMMFDLLPDLGHHHQVAHTNSGTVSDIPS
GREKYQFNRGRHYYSAFKKSLRPSGSLKKRTSSGVEKHFKAQSLDLSMDTSHIVESETTT
LGRLLDFQCSDVALTLFSKIQKTRPHPSNLDILSIARSVCCKTSLRAALKAKYGILPDNI
FVKAAKLCSDVGIQIDWHQEEFFCPKGCKSRSSSNSLLPLQPTQVDFVMSPPIGDEIWGM
DEYHYVLDSEHFGWNLKNEMVIVCEDVSFGREKVPVVCAIDVDAKEFPYMKPGEILQSEN
SLPWQGFHYVTKRLMDSSLVDSENTMVGCACSHAHCSPEECDHVSLFDSIYENLVDLHGV
PMRGRFAYDENSKVILQEGYPIYECNSSCTCDASCQNKVLQRGLLVKLEVFRTENKGWAV
RAAEPIPQGTFVCEYIGEVLKMKDDGAIRHVEREAKSGSSYLFEITSQIDRERVQTTGTT
AYVIDATRYGNVSRFINHSCSPNLSTRLVSVESKDCQLAHIGLFANQDILMGEELAYDYG
QKLLPGDGCPCHCGAKNCRGRVY*

5'UTR

chr02:29303049..29303049 (+ strand) : 1 bp

CDS

chr02:29303050..29304018 (+ strand) : 969 bp

chr02:29304166..29304327 (+ strand) : 162 bp

chr02:29305640..29305756 (+ strand) : 117 bp

chr02:29305867..29305976 (+ strand) : 110 bp

chr02:29306232..29306369 (+ strand) : 138 bp

chr02:29306509..29306596 (+ strand) : 88 bp

chr02:29306670..29306777 (+ strand) : 108 bp

3'UTR

chr02:29306778..29307140 (+ strand) : 363 bp

FASTA

>Os02t0708600-01 class=Sequence position=chr02:29303049..29307140 (+ strand)
CAAAAGAACA GAAAGGGCAA GTGATGAGCT CCTTTATGAT AACCATAACC TTGGTAAGGA TGATGGTTTA CAGAAGTTCA
CCTGCAGATT ATGTGGGATG ATGTTTGATC TTTTGCCAGA TCTTGGCCAC CACCATCAAG TTGCTCATAC AAACTCAGGT
ACAGTCAGTG ATATCCCTTC AGGACGTGAA AAGTATCAGT TTAACCGTGG TCGGCACTAT TATTCAGCCT TCAAGAAAAG
TTTAAGACCA TCCGGCTCAT TGAAGAAGAG GACTAGTTCT GGAGTTGAGA AACATTTTAA GGCTCAAAGC TTGGATCTAT
CTATGGATAC ATCACACATT GTGGAATCTG AGACCACCAC CCTTGGTAGG TTACTGGATT TCCAATGCTC AGACGTGGCA
TTGACTTTAT TTTCAAAGAT TCAAAAGACA AGACCCCACC CAAGCAACCT TGATATTCTG TCTATTGCCC GTTCTGTTTG
CTGTAAGACA AGCCTTCGTG CTGCATTGAA AGCTAAATAT GGAATCTTGC CTGATAACAT ATTTGTGAAA GCTGCAAAGC
TTTGTAGTGA TGTTGGCATC CAAATTGATT GGCATCAAGA AGAATTCTTT TGCCCTAAAG GTTGCAAGTC CAGGTCTAGT
TCTAATTCCT TGCTCCCTTT ACAGCCTACC CAAGTTGATT TTGTGATGAG TCCTCCAATT GGTGATGAGA TATGGGGCAT
GGATGAATAC CACTATGTTC TTGATTCAGA GCACTTTGGT TGGAATCTTA AGAATGAGAT GGTTATTGTT TGTGAAGATG
TTAGCTTTGG CAGGGAGAAA GTTCCAGTTG TCTGTGCCAT TGATGTAGAT GCAAAAGAAT TTCCATATAT GAAACCTGGA
GAAATTTTGC AAAGTGAAAA TTCTCTGCCC TGGCAAGGTT TCCACTACGT CACAAAGCGT TTGATGGATT CATCTCTTGT
TGATTCAGAG GTATTTTCTG GATTTTGCTT TTATGATGAA CAGAAACTTG CATATTAATT GAACGAAAGG AACCAAGACT
ATTTTTCTTT GGTTTTTATA TATTGCAACT TTTTTGTCTC CTGCAACTTA GTCTTCTAAT AAGTTGCTTA CCTGCAGAAC
ACTATGGTTG GGTGTGCTTG TTCTCATGCC CATTGCAGTC CTGAGGAATG TGATCATGTG AGCCTCTTTG ATAGTATCTA
TGAGAACCTA GTGGATCTCC ATGGTGTACC TATGCGTGGT AGATTTGCAT ATGATGAAAA TAGCAAAGTT ATTTTGCAGG
TAATAATTGT TACTGGCGTA TATTTTTACC TACACATGTT TTTTTGACAA GTACTCTAGC ATGTATGGCT TTAGGAACAT
TGGAAATATG AACAGAAATG TGCACTAGTA CCACCATCAA TTTCTGTTCA AGAATGTGGG TTTTGACCAA CGCAAGGGAA
GTCTTACATT TGTTTTCTCC AAAATGACCA AACTATCCTA ATAAATAATC TCTTGTCCAC TTTTCTCCAC AAATGGGATG
AGGATGGGAG ATATTAAATA AGAGCAAAAT GTGAAGCTGT GCTTTGGAAA AAAATGACAT GTCCTCCGTA TCGTGAACCA
ATAAAGTAGT CAAAAGTGGC CAGTATTTGT GAATGGAGTT GTGCTGGCTG TTCTTGGTTG TGATATCCAA AGCGATTTCG
AATTTTGAAG CTTGGCTTTT AAGAATAATT TTAGGTAGAT TTTTTAGTTG TCTTCTTAAC AGTCATGAAC ATAGAGCTGG
GCAATGAAAG AGATGAAATA ACCCTTAAAA GTTAATCCTA AATCGAAATC TAAAATTTAA AATCACCTTT GGATTAATCC
AAAGCACAAG CAAGCGCAGC CCCATTGATC TGATCATTGA TACCTTGATA TCTGTGACTA GCTGGTAATG CAACCTTTTT
TTTCTTTATG ATGCAAGCAC ACTACATTTT TCTCAAGAAG TTTGCCATCT TATTTTGAAA TTTAGCTTAA ACTGCGATTA
AATAAATACC TATCATTGTG TGTTGCCATC TCCCTGAGCT CAATATCATG TCCACTTATA TGTTCTTATT AAGGATGTCC
TTATCCACTA TGGTGTTCGT GTATAGCATA CTCTAACCTG TTTTAATTAC TAATGCAATC TCTGAGTCCC ATAGCTGTAT
CAAAAGCCTT CTGTTGCTAT TCACCCTTAA ACTTACTTCT GGAGAGCTGC AGAAACAATA GTAGATTGGT TCTTTAACCA
TAATTTACAG GCTCCACATC CATGGTGACA TTATCGCATA CAACGGTTTC ATCTAAAAAA CAAACCTCTT TATTTTGTCG
TGATTTGACC TTTACATCCA TGGTGGCATT ATCTCGTTCA TCTTTTATGG TGACATAACT AATTCCAATA GCTATCTGCC
AATGTCAAAA GGGATGTGCG TGGGATTTGG GCTCATTGAT ATTGAGTTGT TCTTCAGGTC TGCAGATAAT GTCTGACTGA
GTATTTGTAC ACCTTTTGCT TGAGCTCATT TCAAAGATAT CCATCATCTA GGCATTCATT TCTCATCATT TTATTGTATA
ATTTGATGTC TATGTGTTGT TAAATTTGCA GGAAGGATAT CCTATATATG AGTGCAATTC ATCATGCACT TGTGATGCCT
CCTGTCAGAA TAAAGTACTG CAGAGAGGAC TGCTGGTAAA GTTGGAAGTC TTCAGAACTG AGAATAAGGT GAAATATTCT
CCACTTGTTT TTTTGGTTTC CTGAGCGTTG CACCTTACCT TTGACGTCAA GATAAAACCT GCTTACAAGT GATATTTTTG
TTTTGTCAAA TGCTGCAGGG TTGGGCTGTT AGAGCCGCAG AACCTATTCC ACAGGGCACA TTTGTATGTG AGTACATTGG
AGAGGTTTTG AAGATGAAGG ATGATGGGGC CATAAGACAT GTAGAAAGGT TTGATGATTC TCTTGTTATT TCTTTTATTT
AGGCTAGAAA TCTATTGGAA TTTCTCCGGT GCATTCCATG TAAGCTTCAT TGAATTTTCT TGGTCATTAT GATGCCCAGT
CTTGCCTAAA TGCCCAATCT CTGCCTAAAC TATATTTTCA TCTTGCACAC ATTCTGGTTT CACGCTGTTC TTGTTCTATA
GTCTGAACAT TTGGAGTATT ATTATTATGC TCAGAAACTG ATAAGAAAAT TATTGGATCT CAGGGAGGCA AAAAGTGGTA
GCAGCTACTT GTTTGAAATC ACTTCTCAGA TTGACAGGGA AAGAGTTCAG ACTACAGGGA CTACTGCATA CGTGATTGAT
GCCACAAGAT ATGGCAACGT ATCCCGTTTT ATTAATCATA GGTAACTGGA CTATTTTATG TCTGTCCCAA AATATATTAA
CTTAGAAGTT AATATATTTT GGGATGGAAG GAGTACTTGG GAACATCTTA CTACGGGATA AATTTGTTCT GGAACCAATG
CTTTTGCCCC TTCATTGCAG CTGTTCCCCA AATCTCAGTA CGCGTTTAGT TTCGGTGGAG AGCAAAGACT GTCAGCTTGC
GCACATTGGT TTGTTTGCAA ACCAGGATGT AAGAATTTTT TGACCACCTC ATCCTACATC GTTATACGTA CCTTGCTAAT
TGTTGTTTCA CTGTTGTCCA GATCTTGATG GGAGAAGAAT TGGCCTATGA CTATGGACAA AAATTGCTAC CTGGTGATGG
ATGCCCCTGC CATTGTGGTG CTAAGAATTG CCGAGGACGT GTGTATTGAG TTTGCAGTGG GGCAGAAAAT GGTAACGGAG
CAGTCCAATC CTTAGCATAT CTCCAGAAGT TCCTACAATG GCGTCACTTA GCAAGGGATA GCAATGTTTT TTTCTAGAGC
AACAATGCAG TGCTAGGATC TAATTCCCCA TGCATCATTA GGAATCATCA TATAGGTCTC TCAACAGTTA TTAGGCACAC
CATACGATTG ATTTTAGTGT GGCACACTTA TGCTTAACTG ATCATTTGTT AGGAGCAACC TGAAATGAAA GCAGTTCAGG
CTGCATTGTT CGTAGGCCAG AAGTGAAGTG TCGTTGTAAC ATACCTTCAT TCAATTTTTA CTGCTCATAA GCGCCATCGT
CGAAGTTGAA CC

Locus: Os02g0708600

Loading...

Locus: Os02g0708600

Loading...