Os02t0710300-01

Locus

Os02g0710300

Description

ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development

RAP-DB Gene Symbol Synonym(s)

OsbHLH126, OsRSL2

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 126

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH126, bHLH126, OsRSL2, RSL2

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 126, ROOT HAIR DEFECTIVE-SIX LIKE 2

Transcript Evidence

AK109662

Protein Evidence

Q0DY80

Literature

PMID: 27494519

PMID: 27716929

Note

Manual Curation

October 4, 2016

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Full-length cDNA

002-143-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0710300-01)

RiceXPro (AK109662)

Others

Oryzabase (15404)

KEGG (Os02t0710300-01)

Transcript

1397 bp

>Os02t0710300-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
ACACCACACTGCAGACTGCACCACCACACGCCGCGCCGCCGAGGAGAAGGGTGTGCGTGT
GACTGATCGACGACGGAGGAGCGCGTGTACGTTGCCGAGGCGACGAAGGGTGCAGTGATC
GTATTTGTTGGTAGTGTACTAGTGTGCATGCGCATGGCGCTGGTGCGGGAGCGCGCGATG
GTGTACGGTGGAGGGTGCGACGCCGAGGCGTTCGGCGGCGGGTTCGAGTCGTCCCAGATG
GGGTACGGCCACGACGCGCTGCTCGACATCGACGCGGCGGCGCTGTTCGGGGGGTACGAG
GCGGCCGCCAGCGCCGGGTGCGCCCTCGTGCAGGACGGCGCCGCGGGGTGGGCGGGCGCG
GGCGCGTCGTCCTCGGTGCTGGCGTTCGACCGCGCCGCTCAGGCGGAGGAGGCCGAGTGC
GACGCGTGGATCGAAGCCATGGACCAGAGCTACGGCGCCGGCGGCGAGGCGGCGCCGTAC
CGGTCGACGACGGCCGTCGCCTTCGACGCGGCCACCGGCTGCTTCAGCCTGACGGAGAGA
GCCACCGGCGGCGGCGGCGGCGCGGGTGGGCGGCAGTTCGGGCTGCTGTTCCCGAGCACG
TCGGGCGGCGGCGTCTCCCCCGAACGCGCCGCGCCGGCGCCGGCGCCCCGCGGCTCGCAG
AAGCGGGCCCACGCGGAGTCGTCGCAGGCCATGAGCCCTAGCAAGAAGCAGTGCGGCGCC
GGCAGGAAGGCGGGCAAGGCCAAGTCGGCGCCGACCACCCCAACCAAGGACCCGCAAAGC
CTCGCGGCCAAGAATCGGCGCGAGAGGATCAGCGAGCGGCTGCGGATCCTGCAGGAGCTC
GTGCCCAACGGCACCAAGGTCGACCTCGTCACCATGCTCGAGAAGGCCATCAGCTACGTC
AAGTTCCTCCAGCTTCAAGTCAAGGTTCTTGCGACGGACGAGTTCTGGCCGGCGCAGGGA
GGGAAGGCGCCGGAGATATCCCAGGTGAAGGAGGCGCTCGACGCCATCTTGTCGTCGTCG
TCGCCGCTGATGGGACAACTCATGAACTGAACTACTACTGTAGAAGAAGAAACTACGATA
GAAATTATTAATCAATAACGAACCACCTCGTTCGAAGATAAATAATCAAGGGAGGCATAT
GCATACGTACGCAGGCACAAAACTTTTGTTTTTTTTCTCTCGCCACTGATCATTAGCGCT
ATCAATGTACCTTTTTTTAGGGGAGTTAATTAGCGTGACACACGTACAGGGAGGTTTAAC
ATTTTGCTAAACCTTGTGGTCATGTTCTTGTGTACTGCGACTAAATACAACCCCCTTTTC
TCTCTTCATGATATGGATCGTTCCATCATGTAAGTTTTAGTCAGATCAAAACATGTAACA
GTGGTTAGTCAGGTGTC

CDS

903 bp

>Os02t0710300-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
ATGCGCATGGCGCTGGTGCGGGAGCGCGCGATGGTGTACGGTGGAGGGTGCGACGCCGAG
GCGTTCGGCGGCGGGTTCGAGTCGTCCCAGATGGGGTACGGCCACGACGCGCTGCTCGAC
ATCGACGCGGCGGCGCTGTTCGGGGGGTACGAGGCGGCCGCCAGCGCCGGGTGCGCCCTC
GTGCAGGACGGCGCCGCGGGGTGGGCGGGCGCGGGCGCGTCGTCCTCGGTGCTGGCGTTC
GACCGCGCCGCTCAGGCGGAGGAGGCCGAGTGCGACGCGTGGATCGAAGCCATGGACCAG
AGCTACGGCGCCGGCGGCGAGGCGGCGCCGTACCGGTCGACGACGGCCGTCGCCTTCGAC
GCGGCCACCGGCTGCTTCAGCCTGACGGAGAGAGCCACCGGCGGCGGCGGCGGCGCGGGT
GGGCGGCAGTTCGGGCTGCTGTTCCCGAGCACGTCGGGCGGCGGCGTCTCCCCCGAACGC
GCCGCGCCGGCGCCGGCGCCCCGCGGCTCGCAGAAGCGGGCCCACGCGGAGTCGTCGCAG
GCCATGAGCCCTAGCAAGAAGCAGTGCGGCGCCGGCAGGAAGGCGGGCAAGGCCAAGTCG
GCGCCGACCACCCCAACCAAGGACCCGCAAAGCCTCGCGGCCAAGAATCGGCGCGAGAGG
ATCAGCGAGCGGCTGCGGATCCTGCAGGAGCTCGTGCCCAACGGCACCAAGGTCGACCTC
GTCACCATGCTCGAGAAGGCCATCAGCTACGTCAAGTTCCTCCAGCTTCAAGTCAAGGTT
CTTGCGACGGACGAGTTCTGGCCGGCGCAGGGAGGGAAGGCGCCGGAGATATCCCAGGTG
AAGGAGGCGCTCGACGCCATCTTGTCGTCGTCGTCGCCGCTGATGGGACAACTCATGAAC
TGA

Protein

301 aa

>Os02t0710300-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
MRMALVRERAMVYGGGCDAEAFGGGFESSQMGYGHDALLDIDAAALFGGYEAAASAGCAL
VQDGAAGWAGAGASSSVLAFDRAAQAEEAECDAWIEAMDQSYGAGGEAAPYRSTTAVAFD
AATGCFSLTERATGGGGGAGGRQFGLLFPSTSGGGVSPERAAPAPAPRGSQKRAHAESSQ
AMSPSKKQCGAGRKAGKAKSAPTTPTKDPQSLAAKNRRERISERLRILQELVPNGTKVDL
VTMLEKAISYVKFLQLQVKVLATDEFWPAQGGKAPEISQVKEALDAILSSSSPLMGQLMN
*

5'UTR

chr02:29421401..29421547 (+ strand) : 147 bp

CDS

chr02:29421548..29422192 (+ strand) : 645 bp

chr02:29422290..29422421 (+ strand) : 132 bp

chr02:29422517..29422642 (+ strand) : 126 bp

3'UTR

chr02:29422643..29422989 (+ strand) : 347 bp

FASTA

>Os02t0710300-01 class=Sequence position=chr02:29421401..29422989 (+ strand)
ACACCACACT GCAGACTGCA CCACCACACG CCGCGCCGCC GAGGAGAAGG GTGTGCGTGT GACTGATCGA CGACGGAGGA
GCGCGTGTAC GTTGCCGAGG CGACGAAGGG TGCAGTGATC GTATTTGTTG GTAGTGTACT AGTGTGCATG CGCATGGCGC
TGGTGCGGGA GCGCGCGATG GTGTACGGTG GAGGGTGCGA CGCCGAGGCG TTCGGCGGCG GGTTCGAGTC GTCCCAGATG
GGGTACGGCC ACGACGCGCT GCTCGACATC GACGCGGCGG CGCTGTTCGG GGGGTACGAG GCGGCCGCCA GCGCCGGGTG
CGCCCTCGTG CAGGACGGCG CCGCGGGGTG GGCGGGCGCG GGCGCGTCGT CCTCGGTGCT GGCGTTCGAC CGCGCCGCTC
AGGCGGAGGA GGCCGAGTGC GACGCGTGGA TCGAAGCCAT GGACCAGAGC TACGGCGCCG GCGGCGAGGC GGCGCCGTAC
CGGTCGACGA CGGCCGTCGC CTTCGACGCG GCCACCGGCT GCTTCAGCCT GACGGAGAGA GCCACCGGCG GCGGCGGCGG
CGCGGGTGGG CGGCAGTTCG GGCTGCTGTT CCCGAGCACG TCGGGCGGCG GCGTCTCCCC CGAACGCGCC GCGCCGGCGC
CGGCGCCCCG CGGCTCGCAG AAGCGGGCCC ACGCGGAGTC GTCGCAGGCC ATGAGCCCTA GCAAGAAGCA GTGCGGCGCC
GGCAGGAAGG CGGGCAAGGC CAAGTCGGCG CCGACCACCC CAACCAAGGA CCCGCAAAGC CTCGCGGCCA AGGTAATTAA
ACTTTTACTG AATTCCGCGC CAAAATCCTA CTGCTACTCC GACCAATCCA TGTACCGAAC TGAACTCGAA TTGTTCTTGC
CGGCGGCAGA ATCGGCGCGA GAGGATCAGC GAGCGGCTGC GGATCCTGCA GGAGCTCGTG CCCAACGGCA CCAAGGTCGA
CCTCGTCACC ATGCTCGAGA AGGCCATCAG CTACGTCAAG TTCCTCCAGC TTCAAGTCAA GGTATGCACA CATCTCTCGC
AATGTGCACG CGATTACGCG GTTAGAATTA GAATTTGGAG GTTCTAATTA ACTGTGTTTC TGACGATGAA CTGCAGGTTC
TTGCGACGGA CGAGTTCTGG CCGGCGCAGG GAGGGAAGGC GCCGGAGATA TCCCAGGTGA AGGAGGCGCT CGACGCCATC
TTGTCGTCGT CGTCGCCGCT GATGGGACAA CTCATGAACT GAACTACTAC TGTAGAAGAA GAAACTACGA TAGAAATTAT
TAATCAATAA CGAACCACCT CGTTCGAAGA TAAATAATCA AGGGAGGCAT ATGCATACGT ACGCAGGCAC AAAACTTTTG
TTTTTTTTCT CTCGCCACTG ATCATTAGCG CTATCAATGT ACCTTTTTTT AGGGGAGTTA ATTAGCGTGA CACACGTACA
GGGAGGTTTA ACATTTTGCT AAACCTTGTG GTCATGTTCT TGTGTACTGC GACTAAATAC AACCCCCTTT TCTCTCTTCA
TGATATGGAT CGTTCCATCA TGTAAGTTTT AGTCAGATCA AAACATGTAA CAGTGGTTAG TCAGGTGTC

Locus: Os02g0710300

Loading...

Locus: Os02g0710300

Loading...