Os02t0713400-01

Locus

Os02g0713400

Description

Similar to Thioredoxin reductase 1 (EC 1.8.1.9) (NADPH-dependent thioredoxin reductase 1) (NTR 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NTRB

CGSNL Gene Name

NADPH-DEPENDENT THIOREDOXIN REDUCTASE B

Oryzabase Gene Symbol Synonym(s)

OsNTRB, NtrB

Oryzabase Gene Name Synonym(s)

NADPH-dependent thioredoxin reductase B, NADP-thioredoxin reductase B, NADPH-dependent Trx reductase B

Transcript Evidence

AK071251 (DDBJ, Best hit)

AK104317 (DDBJ, Best hit)

Protein Evidence

B8AHL2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: removal of superoxide radicals (GO:0019430)

Biological Process: oxidation-reduction process (GO:0055114)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: thioredoxin-disulfide reductase activity (GO:0004791)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

Thioredoxin reductase (IPR005982)

Pyridine nucleotide-disulphide oxidoreductase, class-II, active site (IPR008255)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (IPR023753)

Full-length cDNA

J023087H21 (Online Clone Ordering)

001-024-C03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0713400-01)

Others

Oryzabase (14372)

Transcript

1496 bp

>Os02t0713400-01 Similar to Thioredoxin reductase 1 (EC 1.8.1.9) (NADPH-dependent thioredoxin reductase 1) (NTR 1).
CCGTTGATTGGCTCGTCGCCTCCTCCCTTCTCGGTCTGACGGTCTGACCAGTGCCGGGTA
GGAAGCGTAATTTTGAGGAGAGACTCCGACCCGCGCCGCCGCCGCCGCAGCCAAGCCATG
GAGGGATCCGCCGGGGCGCCGCTCCGCACGCGCGTGTGCATCATCGGGAGCGGGCCGTCG
GCGCACACGGCGGCGATCTACGCCGCCCGCGCGGAGCTCAAGCCCGTGCTCTTCGAGGGC
TGGCTCGCCAACGACATCGCGGCGGGGGGCCAGCTCACCACCACCACCGACGTCGAGAAC
TTCCCGGGGTTCCCCGAGGGGATCCTCGGCGGCGAGCTCATGGATCGGTGCCGCGCCCAG
TCCCTCCGGTTCGGCACCAGCATCATCTCCGAGACCGTCACCGCGGTCGACTTCTCCGCC
CGCCCCTTCCGCGTCGCCTCCGACTCCACCACCGTGCTCGCCGACGCCGTCGTCGTCGCC
ACCGGCGCCGTCGCCCGGCGACTCCACTTCGCCGGCTCCGACGCCTACTGGAACCGCGGC
ATCTCCGCCTGCGCCGTCTGCGACGGGGCCGCCCCAATCTTCAGGAACAAACCCATCGCC
GTCATCGGCGGCGGCGACTCCGCCATGGAGGAGTCCAACTTCCTCACCAAGTACGGCTCC
CATGTGTACATCATCCACCGCCGCAACACCTTCCGCGCCTCCAAGATCATGCAGGCCAGG
GCGTTGTCAAACCCCAAGATCCAGGTTTTCTGGGACTCTGAGGTCGTCGAGGCCTACGGC
GGCGAGGGTGGAGGTCCATTGGCTGGTGTCAAGGTGAAGAACTTGGTTACTGGGAAGATC
TCCGACCTTCAGGTGTCCGGTCTCTTCTTCGCCATCGGACATGAACCGGCGACGAAGTTT
CTCGGCGGGCAGCTTGAGCTCGATGCTGATGGGTATGTGGCCACCAAGCCAGGCTCCACG
CACACCAGTGTGAAGGGGGTCTTTGCTGCTGGGGATGTGCAGGACAAGAAGTATCGCCAG
GCTATTACTGCCGCTGGATCAGGGTGCATGGCTGCTTTGGACGCGGAGCACTATCTGCAG
GAGGTCGGTGCACAGGAGGGCAAGGCCGATTGACTATCTCAGGAGGAAGCGACCACCAGC
GTTTCAAGAAGTCCAACGTTGTCGCTGCTGAAAGCTACACTCTGAACGTTTATGCCATGG
GCTGTTCTGACTTCTGAATGCTTCTACCGGATTTTCCTGCCCCTTATTAGCGTCGTATTA
TTTGATGTGCTGGAGATTTATCTGTATTTACGCTGAAGACGACGTATTGCTTGCGGGTAT
CCGCATTTTCTGCATTTGCTTATGATTGAGTTATTGTGACATTTGGCGTTTTTAGTACCA
AACTAGCAAGGAATTGTGTATTCTGAAGACCATTCCGATCAATGCTACTGATATGGTGGA
TATCACTATTGTTTTCCTGGAAAGAGGAGTAATTAGAAGTTCACTAGCAGGTTGCT

CDS

996 bp

>Os02t0713400-01 Similar to Thioredoxin reductase 1 (EC 1.8.1.9) (NADPH-dependent thioredoxin reductase 1) (NTR 1).
ATGGAGGGATCCGCCGGGGCGCCGCTCCGCACGCGCGTGTGCATCATCGGGAGCGGGCCG
TCGGCGCACACGGCGGCGATCTACGCCGCCCGCGCGGAGCTCAAGCCCGTGCTCTTCGAG
GGCTGGCTCGCCAACGACATCGCGGCGGGGGGCCAGCTCACCACCACCACCGACGTCGAG
AACTTCCCGGGGTTCCCCGAGGGGATCCTCGGCGGCGAGCTCATGGATCGGTGCCGCGCC
CAGTCCCTCCGGTTCGGCACCAGCATCATCTCCGAGACCGTCACCGCGGTCGACTTCTCC
GCCCGCCCCTTCCGCGTCGCCTCCGACTCCACCACCGTGCTCGCCGACGCCGTCGTCGTC
GCCACCGGCGCCGTCGCCCGGCGACTCCACTTCGCCGGCTCCGACGCCTACTGGAACCGC
GGCATCTCCGCCTGCGCCGTCTGCGACGGGGCCGCCCCAATCTTCAGGAACAAACCCATC
GCCGTCATCGGCGGCGGCGACTCCGCCATGGAGGAGTCCAACTTCCTCACCAAGTACGGC
TCCCATGTGTACATCATCCACCGCCGCAACACCTTCCGCGCCTCCAAGATCATGCAGGCC
AGGGCGTTGTCAAACCCCAAGATCCAGGTTTTCTGGGACTCTGAGGTCGTCGAGGCCTAC
GGCGGCGAGGGTGGAGGTCCATTGGCTGGTGTCAAGGTGAAGAACTTGGTTACTGGGAAG
ATCTCCGACCTTCAGGTGTCCGGTCTCTTCTTCGCCATCGGACATGAACCGGCGACGAAG
TTTCTCGGCGGGCAGCTTGAGCTCGATGCTGATGGGTATGTGGCCACCAAGCCAGGCTCC
ACGCACACCAGTGTGAAGGGGGTCTTTGCTGCTGGGGATGTGCAGGACAAGAAGTATCGC
CAGGCTATTACTGCCGCTGGATCAGGGTGCATGGCTGCTTTGGACGCGGAGCACTATCTG
CAGGAGGTCGGTGCACAGGAGGGCAAGGCCGATTGA

Protein

332 aa

>Os02t0713400-01 Similar to Thioredoxin reductase 1 (EC 1.8.1.9) (NADPH-dependent thioredoxin reductase 1) (NTR 1).
MEGSAGAPLRTRVCIIGSGPSAHTAAIYAARAELKPVLFEGWLANDIAAGGQLTTTTDVE
NFPGFPEGILGGELMDRCRAQSLRFGTSIISETVTAVDFSARPFRVASDSTTVLADAVVV
ATGAVARRLHFAGSDAYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEESNFLTKYG
SHVYIIHRRNTFRASKIMQARALSNPKIQVFWDSEVVEAYGGEGGGPLAGVKVKNLVTGK
ISDLQVSGLFFAIGHEPATKFLGGQLELDADGYVATKPGSTHTSVKGVFAAGDVQDKKYR
QAITAAGSGCMAALDAEHYLQEVGAQEGKAD*

5'UTR

chr02:29550953..29551069 (+ strand) : 117 bp

CDS

chr02:29551070..29551994 (+ strand) : 925 bp

chr02:29553794..29553864 (+ strand) : 71 bp

3'UTR

chr02:29553865..29554247 (+ strand) : 383 bp

FASTA

>Os02t0713400-01 class=Sequence position=chr02:29550953..29554247 (+ strand)
CCGTTGATTG GCTCGTCGCC TCCTCCCTTC TCGGTCTGAC GGTCTGACCA GTGCCGGGTA GGAAGCGTAA TTTTGAGGAG
AGACTCCGAC CCGCGCCGCC GCCGCCGCAG CCAAGCCATG GAGGGATCCG CCGGGGCGCC GCTCCGCACG CGCGTGTGCA
TCATCGGGAG CGGGCCGTCG GCGCACACGG CGGCGATCTA CGCCGCCCGC GCGGAGCTCA AGCCCGTGCT CTTCGAGGGC
TGGCTCGCCA ACGACATCGC GGCGGGGGGC CAGCTCACCA CCACCACCGA CGTCGAGAAC TTCCCGGGGT TCCCCGAGGG
GATCCTCGGC GGCGAGCTCA TGGATCGGTG CCGCGCCCAG TCCCTCCGGT TCGGCACCAG CATCATCTCC GAGACCGTCA
CCGCGGTCGA CTTCTCCGCC CGCCCCTTCC GCGTCGCCTC CGACTCCACC ACCGTGCTCG CCGACGCCGT CGTCGTCGCC
ACCGGCGCCG TCGCCCGGCG ACTCCACTTC GCCGGCTCCG ACGCCTACTG GAACCGCGGC ATCTCCGCCT GCGCCGTCTG
CGACGGGGCC GCCCCAATCT TCAGGAACAA ACCCATCGCC GTCATCGGCG GCGGCGACTC CGCCATGGAG GAGTCCAACT
TCCTCACCAA GTACGGCTCC CATGTGTACA TCATCCACCG CCGCAACACC TTCCGCGCCT CCAAGATCAT GCAGGCCAGG
GCGTTGTCAA ACCCCAAGAT CCAGGTTTTC TGGGACTCTG AGGTCGTCGA GGCCTACGGC GGCGAGGGTG GAGGTCCATT
GGCTGGTGTC AAGGTGAAGA ACTTGGTTAC TGGGAAGATC TCCGACCTTC AGGTGTCCGG TCTCTTCTTC GCCATCGGAC
ATGAACCGGC GACGAAGTTT CTCGGCGGGC AGCTTGAGCT CGATGCTGAT GGGTATGTGG CCACCAAGCC AGGCTCCACG
CACACCAGTG TGAAGGGGGT CTTTGCTGCT GGGGATGTGC AGGACAAGAA GTATCGCCAG GCTATTACTG CCGCTGGATC
AGGTTTGTGA ATTGATGATT TTTCAGGTTA CCTGTGATTA ATTTTTTTCT GCACTTTCTT AGAGATCAGT CGCTTCATGG
GTTGCTATTT GCTAGTGCGA ATTGCAATAG AAATTGTTCA GGGCTTGAGT ATGTAGTGAG CGAATGATGA TGGTCAAAAT
TAGAACCTTT TTAAGCTATC ATAGAGTTAA CGTGTTTGAG TTTCTGAAAT AAGTGCTTTC ATTATGTATC TAGCATAGTT
GATTAGATAT ACTAACTACC TTTTGGGCAT GTTGAATGCG TGCTCTGTTT CCAAGCTAGG ATTGGGTGTA TTAGTCCTAA
AAAAAGTTAG GTGTATTTGA GGCCGGTTAA TGCTTCCAAA GTACCATGTA GGTTCATATG TTTGACTAAT AAGTAGCTGG
TAGTTAATCA TGGAATTTGT TGAACTGGGA TAAGTGACTT TCAAGCTATT CTGGGATTTT CATAGTTAAG GCATTCCAAA
TATTGTTAGG AATAAAAAAA AGTGCTACTT CCCATTTAGT ATAGAAGAGT GCATTTCAAT TTCTACACTA CAAAGTACGG
ACTGTATTTT TGCAAAAAAA TCAAAAACAG AAGTATGGTC AGTACATCAC TCTGTCACTC CTGTGATGTG AGTTAACTTT
GTTAAGCGTT TACATGCTAA CTGATGTTGC AGCAAGTATT TTTACTAGAG TGCAAGTTAC ATTTTCATGT GGTTAGAGGG
CACATGCAAA ATTCTCCATG CTCAAACTTC AATAATTGGT CATGTTTCGC CATTCTCCCT TCTTGATCCT GTCAGAGATG
GAGTTTGAAC TTATTATTGC ATAAAAGAAT GAATTGGAAT AAACAGAGAC TGGGTTCACT TTCCCTGCGT GCTGTGAACA
TGTGTTCCGG ATGGGCATAA ACAAAGTAAA CTAATATGTT ACCAAGTATG GACTTGCTGA AATAAATTGA CCTTTTTGAT
GGACAACATA GTGGAGGAAT AAGCAGAGAC TGGGTTCACT TTCCATGCAT GCTCTGTAAA CTTGAGTTCC GGATGGTCAT
AAACAAAGta ctccctcgat ccctaaatgt ttgacgccgt tgactttttt aaacatgttt gaccgttcgt cttattcaaa
aaatttaagt aattattaat tcttttccta tcatttgatt cattgttaaa tatactttta tatatacata tagttttaca
tatttaacaa aagtttttga ataagatgaa cggtcaaaca tgttgtaaaa agttaacggc gtcaaacatt tagggaagga
gggagtaATA ATGTTACCAA GTATGGTCTT GGTCAGAAAC AATCCAAATT GGCATTTTTG ATGGACACAG TCATAGGAGA
CTGATTTTAA TCCTGATGTC TGGTTGTTTA GCAAAAATTG GAATCAGGGA ATAAGGCCAG TACTGCTGAT GTAGAATGAA
AGCAGTATGC CATTTCTATA TACTTCAGAA AGAACTACCT TGTTACCTGT CGTGTGAAAG GAAAAAGCCT GATGATAAGA
TTTTCATCTC AGAAGCAGCA TACAGAGTTT TTCCTTTGTG ATTTTCATGT TGGTTGATAC ATGGTCAGTA TGGTTAGTAC
ATGATGAAGC CTTATTATTA TTACTATTAT TTTGTGCTAG CTTGTTTCAG GAGTTTGATC CAATAGACAT GCACTTCAAA
AAAAGAGAGA AATTGTCTAT ATGCATGACT CTGTCGACAA GATCAATTCT AACTCATCAT TGATGGCTAC TGCTGAGCAT
AAAATTTTTG TGGCAGACTT CTAACTCATC ATTGTATCCA GGGTGCATGG CTGCTTTGGA CGCGGAGCAC TATCTGCAGG
AGGTCGGTGC ACAGGAGGGC AAGGCCGATT GACTATCTCA GGAGGAAGCG ACCACCAGCG TTTCAAGAAG TCCAACGTTG
TCGCTGCTGA AAGCTACACT CTGAACGTTT ATGCCATGGG CTGTTCTGAC TTCTGAATGC TTCTACCGGA TTTTCCTGCC
CCTTATTAGC GTCGTATTAT TTGATGTGCT GGAGATTTAT CTGTATTTAC GCTGAAGACG ACGTATTGCT TGCGGGTATC
CGCATTTTCT GCATTTGCTT ATGATTGAGT TATTGTGACA TTTGGCGTTT TTAGTACCAA ACTAGCAAGG AATTGTGTAT
TCTGAAGACC ATTCCGATCA ATGCTACTGA TATGGTGGAT ATCACTATTG TTTTCCTGGA AAGAGGAGTA ATTAGAAGTT
CACTAGCAGG TTGCT

Locus: Os02g0713400

Loading...

Locus: Os02g0713400

Loading...