Os02t0718900-01

Locus

Os02g0718900

Description

ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ANT

CGSNL Gene Name

ADENOSINE NUCLEOTIDE TRANSLOCATOR

Oryzabase Gene Symbol Synonym(s)

ant, ricANC1, ANC1

Oryzabase Gene Name Synonym(s)

adenine nucleotide translocator, "ADP, ATP carrier protein, mitochondrial precursor", "ADP, ATP carrier protein, mitochondrial", ADP/ATP translocase, ATP/ADP translocator

Transcript Evidence

AK073448 (DDBJ, Best hit)

Protein Evidence

NP_001105434.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: mitochondrial inner membrane (GO:0005743)

Molecular Function: transporter activity (GO:0005215)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Mitochondrial carrier protein (IPR002067)

Adenine nucleotide translocator 1 (IPR002113)

Mitochondrial substrate/solute carrier (IPR018108)

Mitochondrial carrier domain (IPR023395)

Full-length cDNA

J033045A20 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0718900-01)

RiceXPro (AK073448)

Others

Oryzabase (485)

KEGG (Os02t0718900-01)

Transcript

1617 bp

>Os02t0718900-01 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
GGCGGAGATAAAAAGGCACGCAGCCGCTCCAAGAAACCCTCGCCCCCACGACGCTCGCTC
TCTCCTCTCTCTCCCTCTTCCGCCGCCGCGCTTGGGGAAGGAAGGAGAAAGCAAGCCATC
GGCCCCCGCCTCCGCCTCCGAAGGGACATTGTTGCTAGTTGGTGATGGCTGAGCAGGCTA
ATCAACCGACTGTCCTTCAGAAGTTCGGTGGCCAGTTCCACCTTGGCTCCAGCTTTTCTG
AAGGTGTACGGGCTCGCAACATCTGCCCATCTGTCTCATCCTATGACAGGCGCTTTACCA
CAAGGAGCTACATGACCCAGGGCCTTGTCAATGGTGGCATCAACGTCCCAATGATGTCGT
CCTCTCCAATTTTTGCTAATGCTCCAGCTGAGAAAGGTGGCAAAAACTTCATGATTGATT
TCCTCATGGGTGGAGTGTCAGCCGCAGTTTCAAAGACTGCTGCTGCTCCGATTGAGCGTG
TGAAGCTGCTTATCCAGAACCAGGATGAAATGATCAAGGCTGGTAGGCTCTCAGAGCCAT
ACAAGGGTATTGGGGACTGCTTCGGACGCACTATCAAGGATGAGGGTTTTGCTTCATTGT
GGAGAGGAAACACTGCCAATGTGATCCGTTACTTCCCCACCCAGGCTTTGAACTTTGCTT
TCAAGGATTACTTCAAGAGGCTGTTCAACTTCAAGAAAGACAAGGATGGTTACTGGAAGT
GGTTTGGTGGCAACCTTGCCTCTGGTGGTGCTGCTGGTGCTTCATCTCTGTTTTTTGTGT
ACTCCCTTGACTATGCTAGGACAAGGTTGGCCAATGATGCGAAGGCTGCCAAGGGAGGAG
GTGAAAGGCAGTTCAATGGCCTTGTGGATGTTTACCGCAAGACTCTCAAGTCAGATGGCA
TTGCTGGGTTGTACCGTGGATTTAACATCTCATGTGTTGGAATCATTGTCTACCGTGGTC
TGTACTTTGGAATGTATGATTCTCTGAAGCCAGTTGTACTCACTGGGTCTCTCCAGGACA
ATTTCTTTGCAAGCTTTGCCCTTGGGTGGCTGATCACCAACGGTGCAGGTCTTGCCTCTT
ACCCCATTGATACCGTCCGCAGAAGGATGATGATGACCTCTGGAGAGGCTGTCAAGTACA
AGAGCTCCATGGATGCTTTCTCCCAGATCCTGAAGAACGAGGGTGCCAAGTCACTGTTCA
AGGGTGCTGGTGCCAACATCCTACGTGCCATTGCTGGTGCTGGTGTGCTCTCAGGCTATG
ACCAGCTGCAGATCCTCTTCTTTGGAAAGAAGTACGGCTCGGGCGGTGCCTAAACTGGCA
GAAAATGATGACGAACAAGTGTTTATTCCTGGTCCTGCACTAACGGGATCTGGTGAATTT
TGCCTTTTTAACATTGAAAACAATAATAATTCTTGTAGGGGAGAACACTCCCCGACATTC
GTTTTTTGGTGGAAGCGTTTATCTCCAAACATTGTCATAGGCGGAGGCGTTAATCGCAAA
CAGTTTACCATCATAGGGTTGAGTTTGAGTTGAGTCTGGCCGGCTCTGTTATGTCTGGCG
ATTTTCCTACCATACATTACCCTCGGTGAAATATCGAAAGATTATTGAGTTGCTGTC

CDS

1149 bp

>Os02t0718900-01 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
ATGGCTGAGCAGGCTAATCAACCGACTGTCCTTCAGAAGTTCGGTGGCCAGTTCCACCTT
GGCTCCAGCTTTTCTGAAGGTGTACGGGCTCGCAACATCTGCCCATCTGTCTCATCCTAT
GACAGGCGCTTTACCACAAGGAGCTACATGACCCAGGGCCTTGTCAATGGTGGCATCAAC
GTCCCAATGATGTCGTCCTCTCCAATTTTTGCTAATGCTCCAGCTGAGAAAGGTGGCAAA
AACTTCATGATTGATTTCCTCATGGGTGGAGTGTCAGCCGCAGTTTCAAAGACTGCTGCT
GCTCCGATTGAGCGTGTGAAGCTGCTTATCCAGAACCAGGATGAAATGATCAAGGCTGGT
AGGCTCTCAGAGCCATACAAGGGTATTGGGGACTGCTTCGGACGCACTATCAAGGATGAG
GGTTTTGCTTCATTGTGGAGAGGAAACACTGCCAATGTGATCCGTTACTTCCCCACCCAG
GCTTTGAACTTTGCTTTCAAGGATTACTTCAAGAGGCTGTTCAACTTCAAGAAAGACAAG
GATGGTTACTGGAAGTGGTTTGGTGGCAACCTTGCCTCTGGTGGTGCTGCTGGTGCTTCA
TCTCTGTTTTTTGTGTACTCCCTTGACTATGCTAGGACAAGGTTGGCCAATGATGCGAAG
GCTGCCAAGGGAGGAGGTGAAAGGCAGTTCAATGGCCTTGTGGATGTTTACCGCAAGACT
CTCAAGTCAGATGGCATTGCTGGGTTGTACCGTGGATTTAACATCTCATGTGTTGGAATC
ATTGTCTACCGTGGTCTGTACTTTGGAATGTATGATTCTCTGAAGCCAGTTGTACTCACT
GGGTCTCTCCAGGACAATTTCTTTGCAAGCTTTGCCCTTGGGTGGCTGATCACCAACGGT
GCAGGTCTTGCCTCTTACCCCATTGATACCGTCCGCAGAAGGATGATGATGACCTCTGGA
GAGGCTGTCAAGTACAAGAGCTCCATGGATGCTTTCTCCCAGATCCTGAAGAACGAGGGT
GCCAAGTCACTGTTCAAGGGTGCTGGTGCCAACATCCTACGTGCCATTGCTGGTGCTGGT
GTGCTCTCAGGCTATGACCAGCTGCAGATCCTCTTCTTTGGAAAGAAGTACGGCTCGGGC
GGTGCCTAA

Protein

382 aa

>Os02t0718900-01 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
MAEQANQPTVLQKFGGQFHLGSSFSEGVRARNICPSVSSYDRRFTTRSYMTQGLVNGGIN
VPMMSSSPIFANAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG
RLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDK
DGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKT
LKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDNFFASFALGWLITNG
AGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGAG
VLSGYDQLQILFFGKKYGSGGA*

5'UTR

chr02:29821936..29822079 (+ strand) : 144 bp

chr02:29823288..29823307 (+ strand) : 20 bp

CDS

chr02:29823308..29823787 (+ strand) : 480 bp

chr02:29824066..29824437 (+ strand) : 372 bp

chr02:29824520..29824816 (+ strand) : 297 bp

3'UTR

chr02:29824817..29825120 (+ strand) : 304 bp

FASTA

>Os02t0718900-01 class=Sequence position=chr02:29821936..29825120 (+ strand)
GGCGGAGATA AAAAGGCACG CAGCCGCTCC AAGAAACCCT CGCCCCCACG ACGCTCGCTC TCTCCTCTCT CTCCCTCTTC
CGCCGCCGCG CTTGGGGAAG GAAGGAGAAA GCAAGCCATC GGCCCCCGCC TCCGCCTCCG AAGGGTGAGC TGCTCCCGTC
GTTTGCCTCT CCTCCTCCCT CCTCTCCTCC TTTTTTGGGT TGTGCTCGGT GGAGACGGTG ATGTATATAT AGATCCGTGG
ATCTGGCTGT GGCTCGCGCA GATCTGCTTG TTTCTTCCAA GTAGACTTGT TACGCCTGTT GGTGTTCGAG TGGTAGGAGC
CCTTGGGCTT TTCCAGGTTC AGATCGACGC CTCCTTCCTC TGGTATGGGA GGATCTCCTG TTCATCTGTT GACTGGGTGG
TCGGTTGCTT AGATCTGTTC TATTTCTGCT TTATTTTGTG CATGTATTGT GTGGTTTGTA GGGTTATGGC TCCCCTGTGC
GCGGATCATG TGGGTTTGGG TTTCGTTTCG TTCGTAGAAT CTTTGGATGT TCGGGTTGGC TCCGAATCTG TAGATCGGAA
GGTCATTGGT CAGGTGGGGA TGGTGGGGCA GCCAAAAGGG TTGCGTTTTT TTACTGGTTT TCTTTATTTT CACTGACGTC
GACTAGATCT GGTCGTCTCA TGTGCCTCAG ATGCGTGATC TGAACGCACA CAACCCCTCC AAACATGACT CTGTTTCTCG
ATTTGATCTG ACCGTGACCG TATTACAGTA ACGATCCATC CTTGTTTATA AACTTGTACA GATTTACTAG TATAATCCTG
TGTTTCATGC ATGCTAGTTT TATACTTCTC ATTACCTGTT GGTAGAATTT AATAATGTGC TCTGGAATTG CGATTCCTTT
TGCTCTGCAC AAAAAGGAAC GGCCCTGCTT GGACAGGGAC CATCCTTTTC TGCGACCTAT TTAAAGTTCT CATGGTGCGT
CGTGATGGTG ATGTGCACTA CTGTGTAGAA CACCTTATAC TGTTTGTCAT CAGGAGTTCC ACTGCAATTT TTAATACATT
CTGGATGCAT TTTTGTAGAG ACTGTACAAT TGTGTAATTA CATGCTTATA TATAGTTTTT TGGGCTTTTG TTCTTGGTAA
ATATCAGTTT ATTAGCTCTT TCCGTTTAGT TTCTTAAGCA CTACCTCTGT TTGTACACCA TGATTTCTTC TAATGAATGA
AATATCTCAA CAATAAATCT TTCTTCTGCA CTGTCTGTTC GTATGCTATG ATTTCTTTTG AGTGAAATAT CTGAACTACA
AATATTTTGA GTGAAATATT TTGCCTGTGA TCCTGGATTT CTAAACCAGT ACTGTTGCCT TTTATGATGC AGGACATTGT
TGCTAGTTGG TGATGGCTGA GCAGGCTAAT CAACCGACTG TCCTTCAGAA GTTCGGTGGC CAGTTCCACC TTGGCTCCAG
CTTTTCTGAA GGTGTACGGG CTCGCAACAT CTGCCCATCT GTCTCATCCT ATGACAGGCG CTTTACCACA AGGAGCTACA
TGACCCAGGG CCTTGTCAAT GGTGGCATCA ACGTCCCAAT GATGTCGTCC TCTCCAATTT TTGCTAATGC TCCAGCTGAG
AAAGGTGGCA AAAACTTCAT GATTGATTTC CTCATGGGTG GAGTGTCAGC CGCAGTTTCA AAGACTGCTG CTGCTCCGAT
TGAGCGTGTG AAGCTGCTTA TCCAGAACCA GGATGAAATG ATCAAGGCTG GTAGGCTCTC AGAGCCATAC AAGGGTATTG
GGGACTGCTT CGGACGCACT ATCAAGGATG AGGGTTTTGC TTCATTGTGG AGAGGAAACA CTGCCAATGT GATCCGTTAC
TTCCCCACCC AGGTAACCTG CAATTTTCAT GATGGTAGCC AAATTTATGT TTTGTATATT ACACTTTGGA ACATCTATGT
AAAACACCTG AACAAAGCAC TACGTTTTGA TGTTCAGTAG CCTGTGTAGT GATTCTATTT ACCTTACATG TTTATCACTT
ATTAAGAAGT TTGAATCAAT CAAAATTTAT TAAGAAAGAA GAGTTCAGGT GTGTTTACAT TCTGTTTGCT TTGTTGCTAT
TGCACTATAG TTCTTTTCTT ATTCTGATGA CTTTTGATTT TGTCTCCTAG GCTTTGAACT TTGCTTTCAA GGATTACTTC
AAGAGGCTGT TCAACTTCAA GAAAGACAAG GATGGTTACT GGAAGTGGTT TGGTGGCAAC CTTGCCTCTG GTGGTGCTGC
TGGTGCTTCA TCTCTGTTTT TTGTGTACTC CCTTGACTAT GCTAGGACAA GGTTGGCCAA TGATGCGAAG GCTGCCAAGG
GAGGAGGTGA AAGGCAGTTC AATGGCCTTG TGGATGTTTA CCGCAAGACT CTCAAGTCAG ATGGCATTGC TGGGTTGTAC
CGTGGATTTA ACATCTCATG TGTTGGAATC ATTGTCTACC GTGGTCTGTA CTTTGGAATG TATGATTCTC TGAAGCCAGT
TGTACTCACT GGGTCTCTCC AGGTTTGTTC TTATTTCTGT CTCAATATTA GTTGTTTTTT GCCCATCTAT GGAACTATTC
TTTAACATCT TCATTGGTTT GCAGGACAAT TTCTTTGCAA GCTTTGCCCT TGGGTGGCTG ATCACCAACG GTGCAGGTCT
TGCCTCTTAC CCCATTGATA CCGTCCGCAG AAGGATGATG ATGACCTCTG GAGAGGCTGT CAAGTACAAG AGCTCCATGG
ATGCTTTCTC CCAGATCCTG AAGAACGAGG GTGCCAAGTC ACTGTTCAAG GGTGCTGGTG CCAACATCCT ACGTGCCATT
GCTGGTGCTG GTGTGCTCTC AGGCTATGAC CAGCTGCAGA TCCTCTTCTT TGGAAAGAAG TACGGCTCGG GCGGTGCCTA
AACTGGCAGA AAATGATGAC GAACAAGTGT TTATTCCTGG TCCTGCACTA ACGGGATCTG GTGAATTTTG CCTTTTTAAC
ATTGAAAACA ATAATAATTC TTGTAGGGGA GAACACTCCC CGACATTCGT TTTTTGGTGG AAGCGTTTAT CTCCAAACAT
TGTCATAGGC GGAGGCGTTA ATCGCAAACA GTTTACCATC ATAGGGTTGA GTTTGAGTTG AGTCTGGCCG GCTCTGTTAT
GTCTGGCGAT TTTCCTACCA TACATTACCC TCGGTGAAAT ATCGAAAGAT TATTGAGTTG CTGTC

Locus: Os02g0718900

Loading...

Locus: Os02g0718900

Loading...