Os02t0718900-02

Locus

Os02g0718900

Description

ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ANT

CGSNL Gene Name

ADENOSINE NUCLEOTIDE TRANSLOCATOR

Oryzabase Gene Symbol Synonym(s)

ant, ricANC1, ANC1

Oryzabase Gene Name Synonym(s)

adenine nucleotide translocator, "ADP, ATP carrier protein, mitochondrial precursor", "ADP, ATP carrier protein, mitochondrial", ADP/ATP translocase, ATP/ADP translocator

Transcript Evidence

AK119207 (DDBJ, Best hit)

AK100143 (DDBJ, Best hit)

Protein Evidence

NP_001105434.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: mitochondrial inner membrane (GO:0005743)

Molecular Function: transporter activity (GO:0005215)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Mitochondrial carrier protein (IPR002067)

Adenine nucleotide translocator 1 (IPR002113)

Mitochondrial substrate/solute carrier (IPR018108)

Mitochondrial carrier domain (IPR023395)

Full-length cDNA

001-041-E01 (Online Clone Ordering)

J023011P12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0718900-02)

Others

Oryzabase (485)

Transcript

1578 bp

>Os02t0718900-02 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
TCGCCCCCACGACGCTCGCTCTCTCCTCTCTCTCCCTCTTCCGCCGCCGCGCTTGGGGAA
GGAAGGAGAAAGCAAGCCATCGGCCCCCGCCTCCGCCTCCGAAGGGACATTGTTGCTAGT
TGGTGATGGCTGAGCAGGCTAATCAACCGACTGTCCTTCAGAAGTTCGGTGGCCAGTTCC
ACCTTGGCTCCAGCTTTTCTGAAGGTGTACGGGCTCGCAACATCTGCCCATCTGTCTCAT
CCTATGACAGGCGCTTTACCACAAGGAGCTACATGACCCAGGGCCTTGTCAATGGTGGCA
TCAACGTCCCAATGATGTCGTCCTCTCCAATTTTTGCTAATGCTCCAGCTGAGAAAGGTG
GCAAAAACTTCATGATTGATTTCCTCATGGGTGGAGTGTCAGCCGCAGTTTCAAAGACTG
CTGCTGCTCCGATTGAGCGTGTGAAGCTGCTTATCCAGAACCAGGATGAAATGATCAAGG
CTGGTAGGCTCTCAGAGCCATACAAGGGTATTGGGGACTGCTTCGGACGCACTATCAAGG
ATGAGGGTTTTGCTTCATTGTGGAGAGGAAACACTGCCAATGTGATCCGTTACTTCCCCA
CCCAGGCTTTGAACTTTGCTTTCAAGGATTACTTCAAGAGGCTGTTCAACTTCAAGAAAG
ACAAGGATGGTTACTGGAAGTGGTTTGGTGGCAACCTTGCCTCTGGTGGTGCTGCTGGTG
CTTCATCTCTGTTTTTTGTGTACTCCCTTGACTATGCTAGGACAAGGTTGGCCAATGATG
CGAAGGCTGCCAAGGGAGGAGGTGAAAGGCAGTTCAATGGCCTTGTGGATGTTTACCGCA
AGACTCTCAAGTCAGATGGCATTGCTGGGTTGTACCGTGGATTTAACATCTCATGTGTTG
GAATCATTGTCTACCGTGGTCTGTACTTTGGAATGTATGATTCTCTGAAGCCAGTTGTAC
TCACTGGGTCTCTCCAGGACAATTTCTTTGCAAGCTTTGCCCTTGGGTGGCTGATCACCA
ACGGTGCAGGTCTTGCCTCTTACCCCATTGATACCGTCCGCAGAAGGATGATGATGACCT
CTGGAGAGGCTGTCAAGTACAAGAGCTCCATGGATGCTTTCTCCCAGATCCTGAAGAACG
AGGGTGCCAAGTCACTGTTCAAGGGTGCTGGTGCCAACATCCTACGTGCCATTGCTGGTG
CTGGTGTGCTCTCAGGCTATGACCAGCTGCAGATCCTCTTCTTTGGAAAGAAGTACGGCT
CGGGCGGTGCCTAAACTGGCAGAAAATGATGACGAACAAGTGTTTATTCCTGGTCCTGCA
CTAACGGGATCTGGTGAATTTTGCCTTTTTAACATTGAAAACAATAATAATTCTTGTAGG
GGAGAACACTCCCCGACATTCGTTTTTTGGTGGAAGCGTTTATCTCCAAACATTGTCATA
GGCGGAGGCGTTAATCGCAAACAGTTTACCATCATAGGGTTGAGTTTGAGTTGAGTCTGG
CCGGCTCTGTTATGTCTGGCGATTTTCCTACCATACATTACCCTCGGTGAAATATCGAAA
GATTATTGAGTTGCTGTC

CDS

1149 bp

>Os02t0718900-02 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
ATGGCTGAGCAGGCTAATCAACCGACTGTCCTTCAGAAGTTCGGTGGCCAGTTCCACCTT
GGCTCCAGCTTTTCTGAAGGTGTACGGGCTCGCAACATCTGCCCATCTGTCTCATCCTAT
GACAGGCGCTTTACCACAAGGAGCTACATGACCCAGGGCCTTGTCAATGGTGGCATCAAC
GTCCCAATGATGTCGTCCTCTCCAATTTTTGCTAATGCTCCAGCTGAGAAAGGTGGCAAA
AACTTCATGATTGATTTCCTCATGGGTGGAGTGTCAGCCGCAGTTTCAAAGACTGCTGCT
GCTCCGATTGAGCGTGTGAAGCTGCTTATCCAGAACCAGGATGAAATGATCAAGGCTGGT
AGGCTCTCAGAGCCATACAAGGGTATTGGGGACTGCTTCGGACGCACTATCAAGGATGAG
GGTTTTGCTTCATTGTGGAGAGGAAACACTGCCAATGTGATCCGTTACTTCCCCACCCAG
GCTTTGAACTTTGCTTTCAAGGATTACTTCAAGAGGCTGTTCAACTTCAAGAAAGACAAG
GATGGTTACTGGAAGTGGTTTGGTGGCAACCTTGCCTCTGGTGGTGCTGCTGGTGCTTCA
TCTCTGTTTTTTGTGTACTCCCTTGACTATGCTAGGACAAGGTTGGCCAATGATGCGAAG
GCTGCCAAGGGAGGAGGTGAAAGGCAGTTCAATGGCCTTGTGGATGTTTACCGCAAGACT
CTCAAGTCAGATGGCATTGCTGGGTTGTACCGTGGATTTAACATCTCATGTGTTGGAATC
ATTGTCTACCGTGGTCTGTACTTTGGAATGTATGATTCTCTGAAGCCAGTTGTACTCACT
GGGTCTCTCCAGGACAATTTCTTTGCAAGCTTTGCCCTTGGGTGGCTGATCACCAACGGT
GCAGGTCTTGCCTCTTACCCCATTGATACCGTCCGCAGAAGGATGATGATGACCTCTGGA
GAGGCTGTCAAGTACAAGAGCTCCATGGATGCTTTCTCCCAGATCCTGAAGAACGAGGGT
GCCAAGTCACTGTTCAAGGGTGCTGGTGCCAACATCCTACGTGCCATTGCTGGTGCTGGT
GTGCTCTCAGGCTATGACCAGCTGCAGATCCTCTTCTTTGGAAAGAAGTACGGCTCGGGC
GGTGCCTAA

Protein

382 aa

>Os02t0718900-02 ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP translocase) (Adenine nucleotide translocator) (ANT).
MAEQANQPTVLQKFGGQFHLGSSFSEGVRARNICPSVSSYDRRFTTRSYMTQGLVNGGIN
VPMMSSSPIFANAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG
RLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDK
DGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKT
LKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDNFFASFALGWLITNG
AGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGAG
VLSGYDQLQILFFGKKYGSGGA*

5'UTR

chr02:29821975..29822079 (+ strand) : 105 bp

chr02:29823288..29823307 (+ strand) : 20 bp

CDS

chr02:29823308..29823787 (+ strand) : 480 bp

chr02:29824066..29824437 (+ strand) : 372 bp

chr02:29824520..29824816 (+ strand) : 297 bp

3'UTR

chr02:29824817..29825120 (+ strand) : 304 bp

FASTA

>Os02t0718900-02 class=Sequence position=chr02:29821975..29825120 (+ strand)
TCGCCCCCAC GACGCTCGCT CTCTCCTCTC TCTCCCTCTT CCGCCGCCGC GCTTGGGGAA GGAAGGAGAA AGCAAGCCAT
CGGCCCCCGC CTCCGCCTCC GAAGGGTGAG CTGCTCCCGT CGTTTGCCTC TCCTCCTCCC TCCTCTCCTC CTTTTTTGGG
TTGTGCTCGG TGGAGACGGT GATGTATATA TAGATCCGTG GATCTGGCTG TGGCTCGCGC AGATCTGCTT GTTTCTTCCA
AGTAGACTTG TTACGCCTGT TGGTGTTCGA GTGGTAGGAG CCCTTGGGCT TTTCCAGGTT CAGATCGACG CCTCCTTCCT
CTGGTATGGG AGGATCTCCT GTTCATCTGT TGACTGGGTG GTCGGTTGCT TAGATCTGTT CTATTTCTGC TTTATTTTGT
GCATGTATTG TGTGGTTTGT AGGGTTATGG CTCCCCTGTG CGCGGATCAT GTGGGTTTGG GTTTCGTTTC GTTCGTAGAA
TCTTTGGATG TTCGGGTTGG CTCCGAATCT GTAGATCGGA AGGTCATTGG TCAGGTGGGG ATGGTGGGGC AGCCAAAAGG
GTTGCGTTTT TTTACTGGTT TTCTTTATTT TCACTGACGT CGACTAGATC TGGTCGTCTC ATGTGCCTCA GATGCGTGAT
CTGAACGCAC ACAACCCCTC CAAACATGAC TCTGTTTCTC GATTTGATCT GACCGTGACC GTATTACAGT AACGATCCAT
CCTTGTTTAT AAACTTGTAC AGATTTACTA GTATAATCCT GTGTTTCATG CATGCTAGTT TTATACTTCT CATTACCTGT
TGGTAGAATT TAATAATGTG CTCTGGAATT GCGATTCCTT TTGCTCTGCA CAAAAAGGAA CGGCCCTGCT TGGACAGGGA
CCATCCTTTT CTGCGACCTA TTTAAAGTTC TCATGGTGCG TCGTGATGGT GATGTGCACT ACTGTGTAGA ACACCTTATA
CTGTTTGTCA TCAGGAGTTC CACTGCAATT TTTAATACAT TCTGGATGCA TTTTTGTAGA GACTGTACAA TTGTGTAATT
ACATGCTTAT ATATAGTTTT TTGGGCTTTT GTTCTTGGTA AATATCAGTT TATTAGCTCT TTCCGTTTAG TTTCTTAAGC
ACTACCTCTG TTTGTACACC ATGATTTCTT CTAATGAATG AAATATCTCA ACAATAAATC TTTCTTCTGC ACTGTCTGTT
CGTATGCTAT GATTTCTTTT GAGTGAAATA TCTGAACTAC AAATATTTTG AGTGAAATAT TTTGCCTGTG ATCCTGGATT
TCTAAACCAG TACTGTTGCC TTTTATGATG CAGGACATTG TTGCTAGTTG GTGATGGCTG AGCAGGCTAA TCAACCGACT
GTCCTTCAGA AGTTCGGTGG CCAGTTCCAC CTTGGCTCCA GCTTTTCTGA AGGTGTACGG GCTCGCAACA TCTGCCCATC
TGTCTCATCC TATGACAGGC GCTTTACCAC AAGGAGCTAC ATGACCCAGG GCCTTGTCAA TGGTGGCATC AACGTCCCAA
TGATGTCGTC CTCTCCAATT TTTGCTAATG CTCCAGCTGA GAAAGGTGGC AAAAACTTCA TGATTGATTT CCTCATGGGT
GGAGTGTCAG CCGCAGTTTC AAAGACTGCT GCTGCTCCGA TTGAGCGTGT GAAGCTGCTT ATCCAGAACC AGGATGAAAT
GATCAAGGCT GGTAGGCTCT CAGAGCCATA CAAGGGTATT GGGGACTGCT TCGGACGCAC TATCAAGGAT GAGGGTTTTG
CTTCATTGTG GAGAGGAAAC ACTGCCAATG TGATCCGTTA CTTCCCCACC CAGGTAACCT GCAATTTTCA TGATGGTAGC
CAAATTTATG TTTTGTATAT TACACTTTGG AACATCTATG TAAAACACCT GAACAAAGCA CTACGTTTTG ATGTTCAGTA
GCCTGTGTAG TGATTCTATT TACCTTACAT GTTTATCACT TATTAAGAAG TTTGAATCAA TCAAAATTTA TTAAGAAAGA
AGAGTTCAGG TGTGTTTACA TTCTGTTTGC TTTGTTGCTA TTGCACTATA GTTCTTTTCT TATTCTGATG ACTTTTGATT
TTGTCTCCTA GGCTTTGAAC TTTGCTTTCA AGGATTACTT CAAGAGGCTG TTCAACTTCA AGAAAGACAA GGATGGTTAC
TGGAAGTGGT TTGGTGGCAA CCTTGCCTCT GGTGGTGCTG CTGGTGCTTC ATCTCTGTTT TTTGTGTACT CCCTTGACTA
TGCTAGGACA AGGTTGGCCA ATGATGCGAA GGCTGCCAAG GGAGGAGGTG AAAGGCAGTT CAATGGCCTT GTGGATGTTT
ACCGCAAGAC TCTCAAGTCA GATGGCATTG CTGGGTTGTA CCGTGGATTT AACATCTCAT GTGTTGGAAT CATTGTCTAC
CGTGGTCTGT ACTTTGGAAT GTATGATTCT CTGAAGCCAG TTGTACTCAC TGGGTCTCTC CAGGTTTGTT CTTATTTCTG
TCTCAATATT AGTTGTTTTT TGCCCATCTA TGGAACTATT CTTTAACATC TTCATTGGTT TGCAGGACAA TTTCTTTGCA
AGCTTTGCCC TTGGGTGGCT GATCACCAAC GGTGCAGGTC TTGCCTCTTA CCCCATTGAT ACCGTCCGCA GAAGGATGAT
GATGACCTCT GGAGAGGCTG TCAAGTACAA GAGCTCCATG GATGCTTTCT CCCAGATCCT GAAGAACGAG GGTGCCAAGT
CACTGTTCAA GGGTGCTGGT GCCAACATCC TACGTGCCAT TGCTGGTGCT GGTGTGCTCT CAGGCTATGA CCAGCTGCAG
ATCCTCTTCT TTGGAAAGAA GTACGGCTCG GGCGGTGCCT AAACTGGCAG AAAATGATGA CGAACAAGTG TTTATTCCTG
GTCCTGCACT AACGGGATCT GGTGAATTTT GCCTTTTTAA CATTGAAAAC AATAATAATT CTTGTAGGGG AGAACACTCC
CCGACATTCG TTTTTTGGTG GAAGCGTTTA TCTCCAAACA TTGTCATAGG CGGAGGCGTT AATCGCAAAC AGTTTACCAT
CATAGGGTTG AGTTTGAGTT GAGTCTGGCC GGCTCTGTTA TGTCTGGCGA TTTTCCTACC ATACATTACC CTCGGTGAAA
TATCGAAAGA TTATTGAGTT GCTGTC

Locus: Os02g0718900

Loading...

Locus: Os02g0718900

Loading...