Os02t0719700-01

Locus

Os02g0719700

Description

IQ calmodulin-binding region domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG6

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 6

Oryzabase Gene Symbol Synonym(s)

OsBAG6

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 6

Transcript Evidence

AK119930 (DDBJ, Best hit)

Protein Evidence

NP_001152525.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

IQ motif, EF-hand binding site (IPR000048)

BAG domain (IPR003103)

Full-length cDNA

002-184-A06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0719700-01)

RiceXPro (AK119930)

Others

Oryzabase (11554)

KEGG (Os02t0719700-01)

Transcript

888 bp

>Os02t0719700-01 IQ calmodulin-binding region domain containing protein.
AATGAAAGCACACGCCCCCGTCTTTTCCCAAAGACGCGAGCTCGCCGCTGCGCAGCATCC
AGATTCCAGATAGTACTATTGGCAAAGCACAGGTTTGGGGCGCCATGGGCTCCTACCACT
ACACCTCCACCTCCCACTTCTTCTTCgccggcggcggcgagggggagtactccagctaca
agggtactggtagcaccgacacccacaggcccaccaccgtgcggatcccggttaccaccc
cgggcccggagcggccgccggacgacgcggcggcggccaggatccaggccgcgttccggg
ggcacctggtgaggaggcacgccgcggccgtccgcggcgccgacgacgaggcgacgcggc
tggagcggctgctccggaggcaggagacagtggacgccgtccgcggcgacgagcgcgagc
gggcgcggttctcggaggcgctcatggccgtgctgctccgcctcgacgccgtcccggggt
actacccggccgtgcgggaggcgcgccgcgccgtgacccgccgcgtggtggggctgcagg
aggtgttcgacgccgtgctcgccgcgcccgacgccgccgacacgtgcggggtccccgcca
gcctggatcaggtcctcgaggggatctggggagagtcgccggctgcgccgccaccgccgc
cgccgccgccgccgccagcGGCGGTGGAGGTGGAGGAGGAGGTGGTGAGGAGTCCGTGCT
GGAGGAGATTTTTCGGGGGAGTGTAGCAAGTGGTGTAAACTGTCAAAAGTGTATGCAACC
GAATTTGTTGGGAAATATGCCGGAAATATGTTGGTGTGTACCTATAAAGTATTAAAGTGG
TGTAGTATAATGCTATGAACAATCACGTAACATAGTAAATAACGGATT

CDS

642 bp

>Os02t0719700-01 IQ calmodulin-binding region domain containing protein.
ATGGGCTCCTACCACTACACCTCCACCTCCCACTTCTTCTTCgccggcggcggcgagggg
gagtactccagctacaagggtactggtagcaccgacacccacaggcccaccaccgtgcgg
atcccggttaccaccccgggcccggagcggccgccggacgacgcggcggcggccaggatc
caggccgcgttccgggggcacctggtgaggaggcacgccgcggccgtccgcggcgccgac
gacgaggcgacgcggctggagcggctgctccggaggcaggagacagtggacgccgtccgc
ggcgacgagcgcgagcgggcgcggttctcggaggcgctcatggccgtgctgctccgcctc
gacgccgtcccggggtactacccggccgtgcgggaggcgcgccgcgccgtgacccgccgc
gtggtggggctgcaggaggtgttcgacgccgtgctcgccgcgcccgacgccgccgacacg
tgcggggtccccgccagcctggatcaggtcctcgaggggatctggggagagtcgccggct
gcgccgccaccgccgccgccgccgccgccgccagcGGCGGTGGAGGTGGAGGAGGAGGTG
GTGAGGAGTCCGTGCTGGAGGAGATTTTTCGGGGGAGTGTAG

Protein

214 aa

>Os02t0719700-01 IQ calmodulin-binding region domain containing protein.
MGSYHYTSTSHFFFAGGGEGEYSSYKGTGSTDTHRPTTVRIPVTTPGPERPPDDAAAARI
QAAFRGHLVRRHAAAVRGADDEATRLERLLRRQETVDAVRGDERERARFSEALMAVLLRL
DAVPGYYPAVREARRAVTRRVVGLQEVFDAVLAAPDAADTCGVPASLDQVLEGIWGESPA
APPPPPPPPPPAAVEVEEEVVRSPCWRRFFGGV*

5'UTR

chr02:29853571..29853674 (+ strand) : 104 bp

CDS

chr02:29853675..29854316 (+ strand) : 642 bp

3'UTR

chr02:29854317..29854458 (+ strand) : 142 bp

FASTA

>Os02t0719700-01 class=Sequence position=chr02:29853571..29854458 (+ strand)
AATGAAAGCA CACGCCCCCG TCTTTTCCCA AAGACGCGAG CTCGCCGCTG CGCAGCATCC AGATTCCAGA TAGTACTATT
GGCAAAGCAC AGGTTTGGGG CGCCATGGGC TCCTACCACT ACACCTCCAC CTCCCACTTC TTCTTCgccg gcggcggcga
gggggagtac tccagctaca agggtactgg tagcaccgac acccacaggc ccaccaccgt gcggatcccg gttaccaccc
cgggcccgga gcggccgccg gacgacgcgg cggcggccag gatccaggcc gcgttccggg ggcacctggt gaggaggcac
gccgcggccg tccgcggcgc cgacgacgag gcgacgcggc tggagcggct gctccggagg caggagacag tggacgccgt
ccgcggcgac gagcgcgagc gggcgcggtt ctcggaggcg ctcatggccg tgctgctccg cctcgacgcc gtcccggggt
actacccggc cgtgcgggag gcgcgccgcg ccgtgacccg ccgcgtggtg gggctgcagg aggtgttcga cgccgtgctc
gccgcgcccg acgccgccga cacgtgcggg gtccccgcca gcctggatca ggtcctcgag gggatctggg gagagtcgcc
ggctgcgccg ccaccgccgc cgccgccgcc gccgccagcG GCGGTGGAGG TGGAGGAGGA GGTGGTGAGG AGTCCGTGCT
GGAGGAGATT TTTCGGGGGA GTGTAGCAAG TGGTGTAAAC TGTCAAAAGT GTATGCAACC GAATTTGTTG GGAAATATGC
CGGAAATATG TTGGTGTGTA CCTATAAAGT ATTAAAGTGG TGTAGTATAA TGCTATGAAC AATCACGTAA CATAGTAAAT
AACGGATT

Locus: Os02g0719700

Loading...

Locus: Os02g0719700

Loading...