Os02t0723400-02

Locus

Os02g0723400

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA8

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA8

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 8, INDOLE-3-ACETIC ACID INDUCIBLE 8-LIKE

Transcript Evidence

AK066518 (DDBJ, Best hit)

Protein Evidence

Q6Z5M0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J013070M23 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0723400-02)

RiceXPro (AK066518)

Others

Oryzabase (10899)

KEGG (Os02t0723400-02)

Transcript

1003 bp

>Os02t0723400-02 AUX/IAA protein family protein.
TTTCTCTAGTGATCTTCTTTTTCTTTTCTTTTGTTTTCTGTCTCTAGCGAACTACTAGTT
CTTGGATCCGATCGACCGACCCTACCACCCTTGATTTCATGGAGTGCATGGCGAGTACTG
AAGAGTCTCTCCCAGCTTCTTCCTCCATGGATAGTTGCAGCGGCGAACTGCCGAcgacga
cgacgacggcgccggcgcaatccacggcgtcttccggctgccgaccgccggcgacggcgg
cgAAGCGGCGGAGTCTGATCAGCACAGATCTTCGCCTCGGGCTCACCCTCTCCTCCGTCG
TCCACATCGACGGCAACAACCCTTCTACCCCAAGGAGTTCCCTCACGACGGCGACAGTGA
CAGCTGATCGAGGCGGCGGCGGCGGCGGCCATGGACGGCGACGGTCACTGTTCGTGAAGG
TGTACATGGAGGGCGTCCCCATCGGCAGGAAGCTGGACCTGCTGCCGCTGGACGGCTACA
AAGGTCTCGTCGCACGGCTCGCCTCCATGTTCAGAGCATCCATCACCTATCATCATTGCC
ATCGACAGTTCGCCGTCGTCGGGATGAAGACGAACAAGGTTCATCATGTTCTGACATACG
AAGACCAGGAGGGAGACTGGATGATGGCTGGAGACGTGCCATGGGAGCTGTTCCTGACAA
GCGTGAAGAGATTGAGGATTGCAAGAGCGGATGACAAGTACTGCTATAGCTGTTGAATAA
TTGGTTAACCAGGATGGTCAATTAATTCTTCCAGAGTTCTTGGATTTCATTCATTCTTAC
TTTGCTCATTTTGGTGGAGCAATTTAGATTTGAGATGATTGTTTTCGGGAGCGAAAATTT
ACTAGTAAAAGCATAGTGATATTGAGCAGAGGATATTGTACAAAATATATTGTACACACT
AGTAAAAGAAAAGAAACATATATATAGAAATACCATTTTACTTCTCAGTCTAGAATAATT
TATTCCGAACTGGCAATTTTACTGTATGAAAAATAATTTTCTC

CDS

618 bp

>Os02t0723400-02 AUX/IAA protein family protein.
ATGGAGTGCATGGCGAGTACTGAAGAGTCTCTCCCAGCTTCTTCCTCCATGGATAGTTGC
AGCGGCGAACTGCCGAcgacgacgacgacggcgccggcgcaatccacggcgtcttccggc
tgccgaccgccggcgacggcggcgAAGCGGCGGAGTCTGATCAGCACAGATCTTCGCCTC
GGGCTCACCCTCTCCTCCGTCGTCCACATCGACGGCAACAACCCTTCTACCCCAAGGAGT
TCCCTCACGACGGCGACAGTGACAGCTGATCGAGGCGGCGGCGGCGGCGGCCATGGACGG
CGACGGTCACTGTTCGTGAAGGTGTACATGGAGGGCGTCCCCATCGGCAGGAAGCTGGAC
CTGCTGCCGCTGGACGGCTACAAAGGTCTCGTCGCACGGCTCGCCTCCATGTTCAGAGCA
TCCATCACCTATCATCATTGCCATCGACAGTTCGCCGTCGTCGGGATGAAGACGAACAAG
GTTCATCATGTTCTGACATACGAAGACCAGGAGGGAGACTGGATGATGGCTGGAGACGTG
CCATGGGAGCTGTTCCTGACAAGCGTGAAGAGATTGAGGATTGCAAGAGCGGATGACAAG
TACTGCTATAGCTGTTGA

Protein

206 aa

>Os02t0723400-02 AUX/IAA protein family protein.
MECMASTEESLPASSSMDSCSGELPTTTTTAPAQSTASSGCRPPATAAKRRSLISTDLRL
GLTLSSVVHIDGNNPSTPRSSLTTATVTADRGGGGGGHGRRRSLFVKVYMEGVPIGRKLD
LLPLDGYKGLVARLASMFRASITYHHCHRQFAVVGMKTNKVHHVLTYEDQEGDWMMAGDV
PWELFLTSVKRLRIARADDKYCYSC*

5'UTR

chr02:30064483..30064580 (+ strand) : 98 bp

CDS

chr02:30064581..30064814 (+ strand) : 234 bp

chr02:30065200..30065395 (+ strand) : 196 bp

chr02:30065501..30065618 (+ strand) : 118 bp

chr02:30065816..30065885 (+ strand) : 70 bp

3'UTR

chr02:30065886..30066172 (+ strand) : 287 bp

FASTA

>Os02t0723400-02 class=Sequence position=chr02:30064483..30066172 (+ strand)
TTTCTCTAGT GATCTTCTTT TTCTTTTCTT TTGTTTTCTG TCTCTAGCGA ACTACTAGTT CTTGGATCCG ATCGACCGAC
CCTACCACCC TTGATTTCAT GGAGTGCATG GCGAGTACTG AAGAGTCTCT CCCAGCTTCT TCCTCCATGG ATAGTTGCAG
CGGCGAACTG CCGAcgacga cgacgacggc gccggcgcaa tccacggcgt cttccggctg ccgaccgccg gcgacggcgg
cgAAGCGGCG GAGTCTGATC AGCACAGATC TTCGCCTCGG GCTCACCCTC TCCTCCGTCG TCCACATCGA CGGCAACAAC
CCTTCTACCC CAAGGCAAGA TTTCGATCTC TGATCATTCT GCACACCTAC TGCTTTAATT TCAGAGAAAT TTTAAGATAC
TTGAGAAGGT ATTCGATACA TAGTCGTAAG AAGTTTGCTT TCGGTCTTTT CGGTTTTCGT Ttttttttcc tcccttgttc
cctggcaatg gccattcgac cggttgcatc gtgtaattga aatcttgcct tttctaatat attgacatgt aactcttttg
cgcattcgtg aaaaaaagaA ACATGTTAAA GAAATTATCT TTATGTGAAG ATACCAATTT TTATACCATA GAAATTAGAA
AATGTGATAT ATGTTAATAA CTTAAGCGAT TATCTTGGTT GCTACTACCT GTTGATCGAG CTTGATCTTA ATTTCTTAGG
AGTTCCCTCA CGACGGCGAC AGTGACAGCT GATCGAGGCG GCGGCGGCGG CGGCCATGGA CGGCGACGGT CACTGTTCGT
GAAGGTGTAC ATGGAGGGCG TCCCCATCGG CAGGAAGCTG GACCTGCTGC CGCTGGACGG CTACAAAGGT CTCGTCGCAC
GGCTCGCCTC CATGTTCAGA GCATCCATCA CCTGTACGTA ACATTATTCA GGCATTGATC GATTTGTCTA TATTGATTGA
TCACTAAACT CTGAAATTGC TGTGGCTAAT TTGCTGTTCA TTTGATCATA TATGCAAGAT CATCATTGCC ATCGACAGTT
CGCCGTCGTC GGGATGAAGA CGAACAAGGT TCATCATGTT CTGACATACG AAGACCAGGA GGGAGACTGG ATGATGGCTG
GAGACGTGCC ATGGGAGTAT GGCAAGCTAG CTCAGCTCTG ACCACCTAAT TTTATATTTA TTTAGACTGA TTATATGATT
AAATTGCATG AGTTTTCAAA ACAACGAAAC ACTGATATAT TTGTCTTTTT TTCTTCTTTA TTAATTCTCA AATTATATCT
TTTGAACTAA TTATGGATTC TCCTTAATCT TTTTTTTTTT TTGGATGAGG CAGGCTGTTC CTGACAAGCG TGAAGAGATT
GAGGATTGCA AGAGCGGATG ACAAGTACTG CTATAGCTGT TGAATAATTG GTTAACCAGG ATGGTCAATT AATTCTTCCA
GAGTTCTTGG ATTTCATTCA TTCTTACTTT GCTCATTTTG GTGGAGCAAT TTAGATTTGA GATGATTGTT TTCGGGAGCG
AAAATTTACT AGTAAAAGCA TAGTGATATT GAGCAGAGGA TATTGTACAA AATATATTGT ACACACTAGT AAAAGAAAAG
AAACATATAT ATAGAAATAC CATTTTACTT CTCAGTCTAG AATAATTTAT TCCGAACTGG CAATTTTACT GTATGAAAAA
TAATTTTCTC 

Locus: Os02g0723400

Loading...

Locus: Os02g0723400

Loading...