Os02t0724000-01

Locus

Os02g0724000

Description

CONSTANS-like protein, Heading promotion under long-day condition

RAP-DB Gene Symbol Synonym(s)

DTH2, OsCCT08, OsBBX7, OsN

RAP-DB Gene Name Synonym(s)

Days to heading on chromosome 2, CCT (CO, CO-LIKE and TOC1) domain protein 8, CCT domain protein 8, B-box-containing protein 7, CONSTANS-like gene N

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsN, OsBBX7, OsCCT08, DTH2

Oryzabase Gene Name Synonym(s)

CONSTANS-like gene N, B-box-containing protein 7, CCT domain-containing gene 8, CCT (CO, CO-LIKE and TOC1) domain protein 8, CCT domain protein 8

Transcript Evidence

AK071630

JX202590 (Asominori)

Protein Evidence

O82118

Literature

PMID: 25563494

PMID: 23388640

Note

Manual Curation

July 6, 2017

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Cellular Component: intracellular (GO:0005622)

Functional domain (InterPro)

Zinc finger, B-box (IPR000315)

CCT domain (IPR010402)

Full-length cDNA

J023105D03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0724000-01)

RiceXPro (AK071630)

Others

Oryzabase (10310)

KEGG (Os02t0724000-01)

Transcript

2023 bp

>Os02t0724000-01 CONSTANS-like protein, Heading promotion under long-day condition
GTGCTTCTCCACCTGTTGTTCCATTTTCTCCTCGCTTATCTCTTCCTCGCTCGCTCTCCC
TTTCGCGCACCAGAAAAGTCGTTTTTTAATTTTCGAGTTTCCGTGGAAGATTCTCGATAC
CTGTCCCTCGTCGTCGTCCTCCTCCGCCGGCCGCCGCCGACGACCGCAGCAGGGGTGGAT
CCGGGGCGGCGCCGATTCGTATCCTGGTAGGATCCCACTGAATTCAACTGTTGAACAAAA
AGCCAGGAAGGTGGCTGTTCTTGTGGCACTCAGTGCTAGTGGAAGTGCTCCAGTACTGTA
CAGGACCATGGATGCTCTTTGTGATTTCTGCAGGGAGCAAAGGTCAATGGTCTATTGCCG
ATCAGATGCAGCATCCTTGTGCTTGTCGTGTGATCGTAATGTGCATTCAGCCAATGCCCT
TTCCCGACGCCATACAAGAACCCTTCTTTGTGATCGTTGTGTTGGACAGCCTGCAGCAGT
CCGTTGTCTTGAAGAGAACACCTCACTTTGCCAAAACTGTGACTGGAATGGACATGGGGC
AGCATCCTCAGCTGCTGGGCATAAAAGGCAGACCATAAACTGTTACTCGGGGTGCCCATC
GTCGGCAGAGCTCTCGAGAATCTGGTCCTTTAGTATGGATATCCCAACTGTAGCTGCGGA
GCCAAACTGTGAGGAAGGAATAAACATGATGAGCATTAATGACAATGACGTCAATAACCA
TTGTGGTGCTCCAGAAGATGGCCGCTTGTTGGATATAGCTAGCACAGCACTCATGAGTGA
TTTACCTACAGGAGACAAGTTCAAACCTTTAATAGGTTCTTCTTCAGGAGATGGGATGAA
TCTTCTGCCACTTAATTCAGATCAGCCAGCTGAGCCAGTTTCAACGACGCCTAAGGCACC
CTGTGTCACAGACAAAGATATGTTCAATGATGGGAGCGTATATGGAGACTTCTGTGTGGA
TGATGCTGACCTAACATTTGAGAATTATGAAGAATTATTCGGTACCTCTCACGTTCAAAC
AGAACAACTCTTTGATGATGCTGGAATTGACAGTTATTTTGAAATGAAGGATGTGCCAGC
AGATGAATCTAATGAGCAGCCCAAACCTGTGCAGCCAGAATGTAGCAATGTCGCATCTGT
TGATTCTGGGATGTCAAACCCAGCTGCAAGGGCTGATTCCAGCCATTGTATTCCTGGTAG
GCAGGCTATATCCAACATATCCCTTTCCTTCTCTGGTTTGACTGGTGAAAGCAGTGCTGG
ATATTTTCAAGATTGTGGGGTATCGTCAATGATCCTTATGGGTGAGCCACCCTGGCATCC
TCCTGGTCCTGAAAGTTCATCTGCTGGAGGCAGCAGAGATAATGCTCTTACACGGTACAA
GGAGAAGAAGAAGAGAAGAAAATTTGACAAGAAGATAAGGTATGCTTCTCGTAAGGCTAG
GGCAGATGTGAGAAAAAGGGTCAAAGGACGGTTTGTAAAGGCTGGCGAAGCATATGACTA
CGATCCGCTGAGCCAAACAAGAAGCTACTAAAGCCTTTCACTCGATTGGTTTCGTCCAGT
GTTCAAGTAGCAATTTTCAGCAGCTGATTTGATGTTGGTTGCACGGCAAGCATGATCACT
GGAGAACACAAGCAATTGCGGCAGACCTTGCAATTGAAAACGGGGAAAGGAAACCAAACG
CTGTGATCAAATCAAATTAATGAAATAAAAAAGGAAAAAATAGGATGCAAACATGCGAGA
AGCTCATGGATGGTAATGCTCCATTTTCTCCTGTACAGTTCATGCATCTTCAGTTGCTTC
TGGTTGAGATGTCTGAATCACTCTCTACCATCTGTGCATTAATCAAATACAAATACATGG
GCCTACCGCACGACGACGAACGCACCTGCTTCTGTTGTGATGTTTTGTGTTGCGGCTGTC
AGGCTGGATCTCTAGGTAACATGATTAATTATACTACTGATGGAATTTGCACCGCTGTAA
TATTATTTACGAATCACAATCTGCCGTGGGATTGTTCTTCTGT

CDS

1224 bp

>Os02t0724000-01 CONSTANS-like protein, Heading promotion under long-day condition
ATGGATGCTCTTTGTGATTTCTGCAGGGAGCAAAGGTCAATGGTCTATTGCCGATCAGAT
GCAGCATCCTTGTGCTTGTCGTGTGATCGTAATGTGCATTCAGCCAATGCCCTTTCCCGA
CGCCATACAAGAACCCTTCTTTGTGATCGTTGTGTTGGACAGCCTGCAGCAGTCCGTTGT
CTTGAAGAGAACACCTCACTTTGCCAAAACTGTGACTGGAATGGACATGGGGCAGCATCC
TCAGCTGCTGGGCATAAAAGGCAGACCATAAACTGTTACTCGGGGTGCCCATCGTCGGCA
GAGCTCTCGAGAATCTGGTCCTTTAGTATGGATATCCCAACTGTAGCTGCGGAGCCAAAC
TGTGAGGAAGGAATAAACATGATGAGCATTAATGACAATGACGTCAATAACCATTGTGGT
GCTCCAGAAGATGGCCGCTTGTTGGATATAGCTAGCACAGCACTCATGAGTGATTTACCT
ACAGGAGACAAGTTCAAACCTTTAATAGGTTCTTCTTCAGGAGATGGGATGAATCTTCTG
CCACTTAATTCAGATCAGCCAGCTGAGCCAGTTTCAACGACGCCTAAGGCACCCTGTGTC
ACAGACAAAGATATGTTCAATGATGGGAGCGTATATGGAGACTTCTGTGTGGATGATGCT
GACCTAACATTTGAGAATTATGAAGAATTATTCGGTACCTCTCACGTTCAAACAGAACAA
CTCTTTGATGATGCTGGAATTGACAGTTATTTTGAAATGAAGGATGTGCCAGCAGATGAA
TCTAATGAGCAGCCCAAACCTGTGCAGCCAGAATGTAGCAATGTCGCATCTGTTGATTCT
GGGATGTCAAACCCAGCTGCAAGGGCTGATTCCAGCCATTGTATTCCTGGTAGGCAGGCT
ATATCCAACATATCCCTTTCCTTCTCTGGTTTGACTGGTGAAAGCAGTGCTGGATATTTT
CAAGATTGTGGGGTATCGTCAATGATCCTTATGGGTGAGCCACCCTGGCATCCTCCTGGT
CCTGAAAGTTCATCTGCTGGAGGCAGCAGAGATAATGCTCTTACACGGTACAAGGAGAAG
AAGAAGAGAAGAAAATTTGACAAGAAGATAAGGTATGCTTCTCGTAAGGCTAGGGCAGAT
GTGAGAAAAAGGGTCAAAGGACGGTTTGTAAAGGCTGGCGAAGCATATGACTACGATCCG
CTGAGCCAAACAAGAAGCTACTAA

Protein

408 aa

>Os02t0724000-01 CONSTANS-like protein, Heading promotion under long-day condition
MDALCDFCREQRSMVYCRSDAASLCLSCDRNVHSANALSRRHTRTLLCDRCVGQPAAVRC
LEENTSLCQNCDWNGHGAASSAAGHKRQTINCYSGCPSSAELSRIWSFSMDIPTVAAEPN
CEEGINMMSINDNDVNNHCGAPEDGRLLDIASTALMSDLPTGDKFKPLIGSSSGDGMNLL
PLNSDQPAEPVSTTPKAPCVTDKDMFNDGSVYGDFCVDDADLTFENYEELFGTSHVQTEQ
LFDDAGIDSYFEMKDVPADESNEQPKPVQPECSNVASVDSGMSNPAARADSSHCIPGRQA
ISNISLSFSGLTGESSAGYFQDCGVSSMILMGEPPWHPPGPESSSAGGSRDNALTRYKEK
KKRRKFDKKIRYASRKARADVRKRVKGRFVKAGEAYDYDPLSQTRSY*

5'UTR

chr02:30094300..30094498 (+ strand) : 199 bp

chr02:30096198..30096305 (+ strand) : 108 bp

CDS

chr02:30096306..30096893 (+ strand) : 588 bp

chr02:30097390..30097590 (+ strand) : 201 bp

chr02:30097861..30098165 (+ strand) : 305 bp

chr02:30098451..30098580 (+ strand) : 130 bp

3'UTR

chr02:30098581..30099072 (+ strand) : 492 bp

FASTA

>Os02t0724000-01 class=Sequence position=chr02:30094300..30099072 (+ strand)
GTGCTTCTCC ACCTGTTGTT CCATTTTCTC CTCGCTTATC TCTTCCTCGC TCGCTCTCCC TTTCGCGCAC CAGAAAAGTC
GTTTTTTAAT TTTCGAGTTT CCGTGGAAGA TTCTCGATAC CTGTCCCTCG TCGTCGTCCT CCTCCGCCGG CCGCCGCCGA
CGACCGCAGC AGGGGTGGAT CCGGGGCGGC GCCGATTCGG TGAGTCCGGT CTCGCGAGCT CGAGCTGTTT GTTTGTTTGT
TTGTTTGGTG GGGATTGGAT TGGGTTGGAT TTGCGTTGTG TAGGCTAGCC GCATCAGCGC CGCTTGTTTG GTGGATTTCG
TGAGCTGCTG CTGGATTAGG GGGCTGGGAT TGGGATTGGG AGGGGGGATG GATCATGGAT GTCGGTGGAT TGGGGGGGAT
TGGGTTTGAG TGTTCGATTT CGAGTCCGCT TGATCGTTTC TGTGGTGTTC CAGGGTGTTT GGTGTTGGGG AGTCTGAACT
GATTTTTTGG TTTTCTTTCT TTTTGCGGAC ACTTCACGCT TTCTCTCGTG TTGCGTGGAG CGTACGTGAG TGGTTTTTGG
TCCGGCTTTA GCTTTGAGCT GGACTTTAGC TGCTCAGAAT TTGATTATTT TTCTTTCTCT AATTGGAGTA CATACAAGTA
CGATGGCTTA GCATGTTTCA GTATCCAGTT CAGTTTTCAA CTAGAAAATA TTAACAATTT CATCCCCTCT GCCCTTTTGT
CTACTGACAT AATAGTCGTG TAGCGGCAAC TGCGGTTAGA TGCAGAAAGG AAGCCCTTTT GTATTCTTAA ATTTGGATAA
TCTTAAAAAA CAAAATAACA TTTCTCTTGC TTATTTGAGT GGCTCAGAAA GTTTGTTGCT TTTATCCACA CACGGCATGC
TTTATATGAT CAGAGAAGTG GGGTTAGTGC TATTTAAAAC TTAGGATTAG TCCCGATAAA ATTGTTTGTA TTGTGGAGAT
GCATGCTTGT TGATTTACAT GATTAGTGCT CAGAAAAGGT GCCCTTTTGA TATGCAAAAT AGGACATACC AGCGTCAAAA
ATAAAGGGAC ATAATAAAAT GAGCAACCAG GATCATTGTT GGATGCACAG CTGGTGAAGT CCTATTTGTA TTGCCGCTTC
TAGCTCTTGC CCATGCATGC TAATAAGCCA TCCCATGCTG GTACGAAAAG TGACTTTTAT TAACTCAGAA ATGCTATCAA
CTGCAGCTAG CATTTGTTTG CTGCATAGCT CCATGTTGCT AATTTCATGT TTTTCCATTG TTATCAGATG CATTGTACTG
CTCTCTGCTA GACTTGTCTA GTGAATTGGT GTTATTGACC CTTATTTTTT AAACATGGAT ACTTTTTTCC CCCTTATATG
CTTTACAGAG AACATGCGCT TACAGGTTAC AGACTGACAG TACATAGGAT AGAAGATAAA ACCGTAACAT TTACCAAGAA
AAACTTCCTG CAAGTAGTTT TGTGCCCTTC TATTTCAGAG ACTTTTGAGT TCTTTATGCC CTTGCTAGCA AATCTTGGGT
GGGATAATAA AACTCAAAAC TCTTCACAAA TTGTTATACG CTACCTATAT TTTAAATTGT TACTAAGTCA ATGAATATAT
TGATTGCTCT TGTTGTGATA CATTTGAAAT GTTTCTGTTG GTTGCAGAGC AATTCAAGTG GTTCATTTCA TGGCCTGTAT
CAATATACTT ATATATCTCC AACACTTACC AAGGAATGGA AACAAACTCA TCATGTAACA TGGGCTGCAA AATCTGTCCC
TTCTTTTCTA ATTTGAAGTG TGCACATATT TGCTATATTT TCCATTAAAA AAATATACTA CTCTCTTTCC ATAATGTTCA
ATTATAAGTT TGTTGTTTTG TTGTTACTGA TTTTTGTTTT TGGCTTTTTG CACACCAGTA TCCTGGTAGG ATCCCACTGA
ATTCAACTGT TGAACAAAAA GCCAGGAAGG TGGCTGTTCT TGTGGCACTC AGTGCTAGTG GAAGTGCTCC AGTACTGTAC
AGGACCATGG ATGCTCTTTG TGATTTCTGC AGGGAGCAAA GGTCAATGGT CTATTGCCGA TCAGATGCAG CATCCTTGTG
CTTGTCGTGT GATCGTAATG TGCATTCAGC CAATGCCCTT TCCCGACGCC ATACAAGAAC CCTTCTTTGT GATCGTTGTG
TTGGACAGCC TGCAGCAGTC CGTTGTCTTG AAGAGAACAC CTCACTTTGC CAAAACTGTG ACTGGAATGG ACATGGGGCA
GCATCCTCAG CTGCTGGGCA TAAAAGGCAG ACCATAAACT GTTACTCGGG GTGCCCATCG TCGGCAGAGC TCTCGAGAAT
CTGGTCCTTT AGTATGGATA TCCCAACTGT AGCTGCGGAG CCAAACTGTG AGGAAGGAAT AAACATGATG AGCATTAATG
ACAATGACGT CAATAACCAT TGTGGTGCTC CAGAAGATGG CCGCTTGTTG GATATAGCTA GCACAGCACT CATGAGTGAT
TTACCTACAG GAGACAAGTT CAAACCTTTA ATAGGTTCTT CTTCAGGAGA TGGGATGAAT CTTCTGCCAC TTAATTCAGA
TCAGCCAGCT GAGCCAGTTT CAACGACGCC TAAGGTGCAT GCTTCTCATT CCCCTCCAAA ACCTATTCAA GTATTCTGCT
AAGTTTCTGC ATAGGTCATA ACATATTGCA TGGACATATT ATTACACCAA ATGTTCACAC TGCGTGGTTG CGGTTTCGAC
CATGTACTTT GTTTTGGTAT TCTTCTAGAA GTGAACGTTC GAAGGGAAAA CTTTCTGTAG TTTGACCAAT GGTACAATGA
CCATCTTTTG GTCATTATTT ATTACTGTTT GCTACTTTCT TAAGAGTTCC ACACTGTCAA AGCTTTCCTG GTGTTTTTCT
CCTGCCGAGC AAGTTACTCT TATCTTCTAA TAATTTTACC ATTGAATGTG AATTCACCTA GATCTTATAA TTCCCTAATG
ATGATGGTTG AACAATTGCT GCAGTTGGAA TTTGTGTATT TCCAATATCA TTATTCATGA AAATGTCATC TGCGATGCCT
GTCATTATGG TGTCACTGCG TGCTTATCGA AACTTGGTTG CATAATTCAG GCACCCTGTG TCACAGACAA AGATATGTTC
AATGATGGGA GCGTATATGG AGACTTCTGT GTGGATGATG CTGACCTAAC ATTTGAGAAT TATGAAGAAT TATTCGGTAC
CTCTCACGTT CAAACAGAAC AACTCTTTGA TGATGCTGGA ATTGACAGTT ATTTTGAAAT GAAGGATGTG CCAGCAGATG
AATCTAATGA GGTCCGTACC TTTCTGCATA TAGTCTTTTT ATCTGCTGTG TTTGTTGTAG GAAAAGAGCT CTGTTTTGCT
ATTTCTGACC TTCCCGCCAT AATCAGGGTT AATCTCGTTT TCCTCCATTT GTGCTTATAT CGAGTTGACC CTACCATTTT
ACTGAGAATC ATTAAATGAT TGATTGGGTT AATTAGGAGT GGAATGTCTG CATATCTCAT CGTCCATTTT ATGGCTATTA
ATTATTTTAC TAAAATTTTG GTATGACTGT TATACTTTCA GCAGCCCAAA CCTGTGCAGC CAGAATGTAG CAATGTCGCA
TCTGTTGATT CTGGGATGTC AAACCCAGCT GCAAGGGCTG ATTCCAGCCA TTGTATTCCT GGTAGGCAGG CTATATCCAA
CATATCCCTT TCCTTCTCTG GTTTGACTGG TGAAAGCAGT GCTGGATATT TTCAAGATTG TGGGGTATCG TCAATGATCC
TTATGGGTGA GCCACCCTGG CATCCTCCTG GTCCTGAAAG TTCATCTGCT GGAGGCAGCA GAGATAATGC TCTTACACGG
TACAAGGAGA AGAAGAAGAG AAGAAAGTAA GTGCATCTTA CTGTGCTTTT TCAGTTTTTT GAAAGTAAGT TCATACTAGT
ACTTGATATG CCATGGTTAA ATGCATTACA GCTAAGAATG TGGCTGCAGT ATCATTCAAT TTTCAGATTT GGAATTCTAT
ATTAAAAAGC TTACTGTGCC AAATCGATAT TTTCGTATAC ACGTGATCAT TTTAGACATG TGGATGCTTG CTCCTAGTGT
GAATGCTACT TTATGTTTTT CTTAAAAGAA GTTATTATAT GGCCTTTCTT CACATATTTT CTTCTTAACA GATTTGACAA
GAAGATAAGG TATGCTTCTC GTAAGGCTAG GGCAGATGTG AGAAAAAGGG TCAAAGGACG GTTTGTAAAG GCTGGCGAAG
CATATGACTA CGATCCGCTG AGCCAAACAA GAAGCTACTA AAGCCTTTCA CTCGATTGGT TTCGTCCAGT GTTCAAGTAG
CAATTTTCAG CAGCTGATTT GATGTTGGTT GCACGGCAAG CATGATCACT GGAGAACACA AGCAATTGCG GCAGACCTTG
CAATTGAAAA CGGGGAAAGG AAACCAAACG CTGTGATCAA ATCAAATTAA TGAAATAAAA AAGGAAAAAA TAGGATGCAA
ACATGCGAGA AGCTCATGGA TGGTAATGCT CCATTTTCTC CTGTACAGTT CATGCATCTT CAGTTGCTTC TGGTTGAGAT
GTCTGAATCA CTCTCTACCA TCTGTGCATT AATCAAATAC AAATACATGG GCCTACCGCA CGACGACGAA CGCACCTGCT
TCTGTTGTGA TGTTTTGTGT TGCGGCTGTC AGGCTGGATC TCTAGGTAAC ATGATTAATT ATACTACTGA TGGAATTTGC
ACCGCTGTAA TATTATTTAC GAATCACAAT CTGCCGTGGG ATTGTTCTTC TGT