Os02t0722350-00

Locus

Os02g0722350

Description

Hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

tplb0041i20 (Wheat FLcDNA)

Protein Evidence

GeneMark

Literature

Note

Manual Curation

Expression Databases

TENOR (Os02t0722350-00)

Transcript

2257 bp

>Os02t0722350-00 Hypothetical protein.
AAAATTCATGGTCTTTTCAGAAAGCATTTGCACAATCAACAAAATTTTAACAAATAAAAG
ATGATGAATGCAAGCTTAAAAGCATATATGCTGGTACATTACTATCACCATATTCATCGT
GGTACAATAGTCCCGGTAATTAGCTACATAAGGAAGACATCACAATTGTGTAAAGGGCCT
TCATGCCATGATCAAATCATTGCCGCTTTAGAGTGATTCAGTGTACAGTCATCCTTGGAG
ATTTGTAAGGTATGGTCTTCAATCAATCTTAACTGATGAGAAAAGGTAGTGGACGAAAGA
GAATGATGTCAGGAACCCAACAGTCCCAGTAGCCAGCATAATTGCAAGAGAGACAACGAA
AGCATATCCAATGTAGAGCGTAGCAGAAACTGGGCCACTCAAGCTTCTGAGATCAAACAC
CAAGTAGTTGATAGAGTACAGGAACACATAAAGCGCTACTGCTCCAGAGGCAAAGAAAGC
TTTCCACCACCAACGCCAATCTTCCGCACAAAGATGCATGTAGGTAAGAACAACAGATAC
CTCAGCACAGACCACAACCAGCAAGAGGAGGACAACAAGGAGGAACCCAAACACATAGTA
GAACCTTCCGAGCCAAATACTTGAAAGAATAAAGAACAACTCAATGAATAGTGTTCCAAA
AGGCAGAGTCCCAGCACCAAGCACAAGGAGCCAAGAGTAATTTTTTGCAGGGATTTCTCT
TGGTATTTGATTGGTTCGAACTGGGAATTCTATTGGCTCAGCCCTTGTGCCAAAGAAACC
ACCGAGGAGGGTAAGTGGCACAGAGATGCAGAACCACAAGGACAGAAGTGTGAAGAAGAG
TGAGATGGGAAGAGCTCCTGTACTATTCCTTGACCACAGCATGAAATTTAACACAGTGAG
GACAACAAAGACAATACCAGGGAAGAAACAGGCTGTTGACCAGGAGACAGATCTCCATCC
CTCAGAAGTTCCTTTTAAAGTCCTCCAGAGCCTAACGGCAGCATATCCAGCCACAATTCC
AAGCAACATATAAAGAAATATCATCCCTGTGAGAAGCATTCCTCTTGATGCAGGAGACAT
GAACCCAAAGGCAGCAAAGAAGATGGTAACAATTGCCATACCCAGAATTTGAACCCCATC
ACCAATCATGACGCAGAGAAGCTTTGATGATGTTGGTTCTCTGAAGACATCACCAACAAC
AAGCTTCCACCCGGAGAGCTCCTCATTCATCTGAGCTTGGGCCTCCTTATCCAATTCCTC
ATATCTAGTCAAGTCTCTCCTCACCGTCCGCAAGAATATGACAAACACAATTCCAGCCAA
AAATAGTATTACCATCAATGAGTTCATGATTGAGAACCAGTGAATTTTAGCACCCTCCAT
CTTCAGGTATGCATCCCACCGTGATGGCCATCTGATATCACTGTTTACAAATTCAACCTC
ATACGTAAAAGTAATCTGCTCTTTTTCCCTAATCAATTGAGATTTCTCCATCTCCACAGG
GCAGCTTGTAGGATCAACTTTTTCATACATCTTAAGCTTTGACATAGCTTCAAGATCACG
CTTCATGCTGCATGGGACAACCTCAAATCCCACAATCTCATAGCCAGACTTGGCATCTGT
CTCTGTCTCTGAGATCACTTCCATTCCTTCCCCAGTTCCAACTACCTTGACTTTACCTCC
TTCGTACCTATGGACCAAGACCTTAAATTTCAGGTGATTAATGATGTAGACCTCATTGCT
TCCTTCCGGGGTATAACCAACTGGATAGCCTGTCCACTGAATGGTCACTCCATTCTGTTC
AGTAAATCTCCTCACAGGAAGATTGTCGAGAATCATGTTCACCTGGTAGAGGTCTCGGCT
TCGCTGCTTGAGGAGCTTCACATCAGCCTCGTCAAGTGGGTTTGTGGTACACAGATACAG
TGATTCATTGACATTCACACGAAACCGGTATGGGGAATTGTCAATCTGGTCACCCATCAG
GAGCTCCCCTAGATTCTCAGCACTCTTCTTTATCCCACCTTGGGGATGGCAGTATGGGAG
ACTGTAGTAGCTGAATGGCAGTTCAGTCTCAATGGAAGTGAGTGAGTTCACCTTTGCCCA
TATTTCCTCGCCTTGCCGGTACGTGTGCATGTAACTGCCTGGCAAATAGAACGCCTCGCA
GTGGGGAGCCAAAACTAGAAACACCATTAACAAGGCAGAGAATATCCTGCCTTTGGCCAT
GACTAGCAAATCCTGGGAAAGTTGACCTAAAATCTGG

CDS

303 bp

>Os02t0722350-00 Hypothetical protein.
TTGGTTCGAACTGGGAATTCTATTGGCTCAGCCCTTGTGCCAAAGAAACCACCGAGGAGG
GTAAGTGGCACAGAGATGCAGAACCACAAGGACAGAAGTGTGAAGAAGAGTGAGATGGGA
AGAGCTCCTGTACTATTCCTTGACCACAGCATGAAATTTAACACAGTGAGGACAACAAAG
ACAATACCAGGGAAGAAACAGGCTGTTGACCAGGAGACAGATCTCCATCCCTCAGAAGTT
CCTTTTAAAGTCCTCCAGAGCCTAACGGCAGCATATCCAGCCACAATTCCAAGCAACATA
TAA

Protein

101 aa

>Os02t0722350-00 Hypothetical protein.
LVRTGNSIGSALVPKKPPRRVSGTEMQNHKDRSVKKSEMGRAPVLFLDHSMKFNTVRTTK
TIPGKKQAVDQETDLHPSEVPFKVLQSLTAAYPATIPSNI*

5'UTR

chr02:29986814..29987543 (- strand) : 730 bp

CDS

chr02:29986511..29986813 (- strand) : 303 bp

3'UTR

chr02:29985287..29986510 (- strand) : 1224 bp

FASTA

>Os02t0722350-00 class=Sequence position=chr02:29985287..29987543 (- strand)
AAAATTCATG GTCTTTTCAG AAAGCATTTG CACAATCAAC AAAATTTTAA CAAATAAAAG ATGATGAATG CAAGCTTAAA
AGCATATATG CTGGTACATT ACTATCACCA TATTCATCGT GGTACAATAG TCCCGGTAAT TAGCTACATA AGGAAGACAT
CACAATTGTG TAAAGGGCCT TCATGCCATG ATCAAATCAT TGCCGCTTTA GAGTGATTCA GTGTACAGTC ATCCTTGGAG
ATTTGTAAGG TATGGTCTTC AATCAATCTT AACTGATGAG AAAAGGTAGT GGACGAAAGA GAATGATGTC AGGAACCCAA
CAGTCCCAGT AGCCAGCATA ATTGCAAGAG AGACAACGAA AGCATATCCA ATGTAGAGCG TAGCAGAAAC TGGGCCACTC
AAGCTTCTGA GATCAAACAC CAAGTAGTTG ATAGAGTACA GGAACACATA AAGCGCTACT GCTCCAGAGG CAAAGAAAGC
TTTCCACCAC CAACGCCAAT CTTCCGCACA AAGATGCATG TAGGTAAGAA CAACAGATAC CTCAGCACAG ACCACAACCA
GCAAGAGGAG GACAACAAGG AGGAACCCAA ACACATAGTA GAACCTTCCG AGCCAAATAC TTGAAAGAAT AAAGAACAAC
TCAATGAATA GTGTTCCAAA AGGCAGAGTC CCAGCACCAA GCACAAGGAG CCAAGAGTAA TTTTTTGCAG GGATTTCTCT
TGGTATTTGA TTGGTTCGAA CTGGGAATTC TATTGGCTCA GCCCTTGTGC CAAAGAAACC ACCGAGGAGG GTAAGTGGCA
CAGAGATGCA GAACCACAAG GACAGAAGTG TGAAGAAGAG TGAGATGGGA AGAGCTCCTG TACTATTCCT TGACCACAGC
ATGAAATTTA ACACAGTGAG GACAACAAAG ACAATACCAG GGAAGAAACA GGCTGTTGAC CAGGAGACAG ATCTCCATCC
CTCAGAAGTT CCTTTTAAAG TCCTCCAGAG CCTAACGGCA GCATATCCAG CCACAATTCC AAGCAACATA TAAAGAAATA
TCATCCCTGT GAGAAGCATT CCTCTTGATG CAGGAGACAT GAACCCAAAG GCAGCAAAGA AGATGGTAAC AATTGCCATA
CCCAGAATTT GAACCCCATC ACCAATCATG ACGCAGAGAA GCTTTGATGA TGTTGGTTCT CTGAAGACAT CACCAACAAC
AAGCTTCCAC CCGGAGAGCT CCTCATTCAT CTGAGCTTGG GCCTCCTTAT CCAATTCCTC ATATCTAGTC AAGTCTCTCC
TCACCGTCCG CAAGAATATG ACAAACACAA TTCCAGCCAA AAATAGTATT ACCATCAATG AGTTCATGAT TGAGAACCAG
TGAATTTTAG CACCCTCCAT CTTCAGGTAT GCATCCCACC GTGATGGCCA TCTGATATCA CTGTTTACAA ATTCAACCTC
ATACGTAAAA GTAATCTGCT CTTTTTCCCT AATCAATTGA GATTTCTCCA TCTCCACAGG GCAGCTTGTA GGATCAACTT
TTTCATACAT CTTAAGCTTT GACATAGCTT CAAGATCACG CTTCATGCTG CATGGGACAA CCTCAAATCC CACAATCTCA
TAGCCAGACT TGGCATCTGT CTCTGTCTCT GAGATCACTT CCATTCCTTC CCCAGTTCCA ACTACCTTGA CTTTACCTCC
TTCGTACCTA TGGACCAAGA CCTTAAATTT CAGGTGATTA ATGATGTAGA CCTCATTGCT TCCTTCCGGG GTATAACCAA
CTGGATAGCC TGTCCACTGA ATGGTCACTC CATTCTGTTC AGTAAATCTC CTCACAGGAA GATTGTCGAG AATCATGTTC
ACCTGGTAGA GGTCTCGGCT TCGCTGCTTG AGGAGCTTCA CATCAGCCTC GTCAAGTGGG TTTGTGGTAC ACAGATACAG
TGATTCATTG ACATTCACAC GAAACCGGTA TGGGGAATTG TCAATCTGGT CACCCATCAG GAGCTCCCCT AGATTCTCAG
CACTCTTCTT TATCCCACCT TGGGGATGGC AGTATGGGAG ACTGTAGTAG CTGAATGGCA GTTCAGTCTC AATGGAAGTG
AGTGAGTTCA CCTTTGCCCA TATTTCCTCG CCTTGCCGGT ACGTGTGCAT GTAACTGCCT GGCAAATAGA ACGCCTCGCA
GTGGGGAGCC AAAACTAGAA ACACCATTAA CAAGGCAGAG AATATCCTGC CTTTGGCCAT GACTAGCAAA TCCTGGGAAA
GTTGACCTAA AATCTGG

Locus: Os02g0722350

Loading...

Locus: Os02g0722350

Loading...