Os02t0725200-01

Locus

Os02g0725200

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET12

Oryzabase Gene Name Synonym(s)

SET protein 12

Transcript Evidence

AK103602 (DDBJ, Best hit)

Protein Evidence

B6U6Z1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: chloroplast (GO:0009507)

Molecular Function: protein binding (GO:0005515)

Molecular Function: [ribulose-bisphosphate carboxylase]-lysine N-methyltransferase activity (GO:0030785)

Functional domain (InterPro)

SET domain (IPR001214)

Rubisco methyltransferase (IPR011192)

Rubisco LS methyltransferase, substrate-binding domain (IPR015353)

Full-length cDNA

J033133G01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725200-01)

RiceXPro (AK103602)

Others

Oryzabase (13378)

KEGG (Os02t0725200-01)

Transcript

1931 bp

>Os02t0725200-01 SET domain containing protein.
GGATAAGCCCCCCGCGCCCGCACACAACCGCACCGCCATTTCGCGGTTCCGCCATGGCCA
CCGCCGCGGCGCTCGCGCTCCACACGCAGTTCCGGCCGCCGCGCTCGCCTCGCCGTCTCC
GGCAGCATCTAGCCTTACCCTCAGGAGTCCTCATCCGATCCCCCGTCCGCGCCTCGGCTG
CGTCGGCGTCGGCGTCGGCGCCGGCGCAGCGGGAGGCCGCCGCCGCGGGAGTCCCGTGGG
GCTGCGAGATCGAGTCCCTGGAGAGCGCCGTGTCGCTGGAGAGGTGGCTCACCGATTCGG
GGCTCCCCGAGCAGAGGTTGGGGATACAGCGGGTGGACGTCGGTGAGCGCGGCCTCGTCG
CGCTGAAGAACATCCGCAAGGGGGAGAAGCTGCTCTTCGTGCCTCCCTCCCTCGTCATTA
CAGCTGACTCAGAATGGGGCTGCCCTGAGGTGGGGAATGTGTTGAAGAGAAATTCTGTGC
CGGATTGGCCGCTTATTGCTACCTACCTTATAAGCGAAGCTAGTTTAGAGAGTTCGTCGA
GGTGGAGCAGCTACATAGCGGCGTTGCCAAGGCAGCCTTACTCTCTGTTGTACTGGACTA
GGCCTGAGCTTGATGCATACTTGGTGGCTTCGCCGATCAGGGAACGCGCAATTCAGAGGA
TCACTGATGTGGTCGGAACATACAATGATCTCCGTGACAGAATATTTTCTAAGCATTCAG
ATTTGTTCCCTGAGGAGGTTTACAACTTAGAGACGTTTAGATGGTCCTTCGGCATCCTCT
TCTCACGCCTGGTTCGATTGCCATCAATGGATGGAAGGGTTGCACTAGTTCCTTGGGCAG
ATATGCTTAACCATAGTCCTGAGGTGGAAACATTCTTGGATTATGATAAATCCTCAGGGG
GAATAGTTTTCACTACCGATCGTTCATATCAACCAGGTGAGCAGGTGTTTATATCCTATG
GCAAGAAATCCAGTGGCGAGCTATTGCTTTCATATGGTTTTGTTCCAAAAGAGGGAACAA
ACCCAAATGATTCAGTTGAATTGCTGGTGTCTCTTAATAAGTCTGATAAGTGCTACAAAG
AGAAGCTACAAGCACTAAAAAGAAATGGATTGTCAGAGTTTGAAAGTTTCCCTTTACGCG
TCACAGGATGGCCAGTTGAGTTGATGGCTTATGCCTTTCTTGTGGTCAGCCCTCCCGAGA
TGAGCCAACGTTTTGAAGAGATGGCTGTCGCTGCATCAAATAAAAGTCCATCCAAGCCTG
GACTTAATTATCCTGAACTGGAGGAACAAGCTCTTCAGTTTATCTTGGACTGTTGTGAGT
CTAACATAGCAAAATACACAAAGTTCCTAGAGGGTAGCAGTGGGTCTCTGCAACTTTCAA
CCAATTCAAAGCAAGCCAACCGGACGTTACTGCTAAAACAACTAGCAAGAGATCTTTGCA
TTAGTGAACGGAGAATCCTGTATCGTACACAATATATATTGCGTAGGAGACTGAGGGACA
TGAGAGGTGGTGAACTTAAAGCTCTGTCATTGTTCAATGGGCTCAGAAAGCTCTTCAAAT
AAAAGGATGGATTTGTTTTTCAATGTTAGCTGAAGATTTCGAGGACAATGTTTAATCTCT
AGTATCTTGCTTCTTCCTTTCAGGTTGTCTTTGTTGCTGATGAAGCTCAGACTGTTGAAG
AAAAGGAAATTGACAAATCAGATTACAATCTCAGCCGACAAGCAACTGATGCTAGAAGAC
TAGAAGTGGTCACAGCTCAATAGAAGACACTAGTTGTAACTTGCGATTGAACAGTCCATA
TCTTGGTTTAAATCTACTATAGCACCATGCAACAATGTACCAGTGGAGTCATCTCGTGTA
TATTTTGTTTCAGGGGTTTCCCCTCGATATCTATAGCATAATATCCCTTCTATTTCTGCT
GTTTTCACCCC

CDS

1509 bp

>Os02t0725200-01 SET domain containing protein.
ATGGCCACCGCCGCGGCGCTCGCGCTCCACACGCAGTTCCGGCCGCCGCGCTCGCCTCGC
CGTCTCCGGCAGCATCTAGCCTTACCCTCAGGAGTCCTCATCCGATCCCCCGTCCGCGCC
TCGGCTGCGTCGGCGTCGGCGTCGGCGCCGGCGCAGCGGGAGGCCGCCGCCGCGGGAGTC
CCGTGGGGCTGCGAGATCGAGTCCCTGGAGAGCGCCGTGTCGCTGGAGAGGTGGCTCACC
GATTCGGGGCTCCCCGAGCAGAGGTTGGGGATACAGCGGGTGGACGTCGGTGAGCGCGGC
CTCGTCGCGCTGAAGAACATCCGCAAGGGGGAGAAGCTGCTCTTCGTGCCTCCCTCCCTC
GTCATTACAGCTGACTCAGAATGGGGCTGCCCTGAGGTGGGGAATGTGTTGAAGAGAAAT
TCTGTGCCGGATTGGCCGCTTATTGCTACCTACCTTATAAGCGAAGCTAGTTTAGAGAGT
TCGTCGAGGTGGAGCAGCTACATAGCGGCGTTGCCAAGGCAGCCTTACTCTCTGTTGTAC
TGGACTAGGCCTGAGCTTGATGCATACTTGGTGGCTTCGCCGATCAGGGAACGCGCAATT
CAGAGGATCACTGATGTGGTCGGAACATACAATGATCTCCGTGACAGAATATTTTCTAAG
CATTCAGATTTGTTCCCTGAGGAGGTTTACAACTTAGAGACGTTTAGATGGTCCTTCGGC
ATCCTCTTCTCACGCCTGGTTCGATTGCCATCAATGGATGGAAGGGTTGCACTAGTTCCT
TGGGCAGATATGCTTAACCATAGTCCTGAGGTGGAAACATTCTTGGATTATGATAAATCC
TCAGGGGGAATAGTTTTCACTACCGATCGTTCATATCAACCAGGTGAGCAGGTGTTTATA
TCCTATGGCAAGAAATCCAGTGGCGAGCTATTGCTTTCATATGGTTTTGTTCCAAAAGAG
GGAACAAACCCAAATGATTCAGTTGAATTGCTGGTGTCTCTTAATAAGTCTGATAAGTGC
TACAAAGAGAAGCTACAAGCACTAAAAAGAAATGGATTGTCAGAGTTTGAAAGTTTCCCT
TTACGCGTCACAGGATGGCCAGTTGAGTTGATGGCTTATGCCTTTCTTGTGGTCAGCCCT
CCCGAGATGAGCCAACGTTTTGAAGAGATGGCTGTCGCTGCATCAAATAAAAGTCCATCC
AAGCCTGGACTTAATTATCCTGAACTGGAGGAACAAGCTCTTCAGTTTATCTTGGACTGT
TGTGAGTCTAACATAGCAAAATACACAAAGTTCCTAGAGGGTAGCAGTGGGTCTCTGCAA
CTTTCAACCAATTCAAAGCAAGCCAACCGGACGTTACTGCTAAAACAACTAGCAAGAGAT
CTTTGCATTAGTGAACGGAGAATCCTGTATCGTACACAATATATATTGCGTAGGAGACTG
AGGGACATGAGAGGTGGTGAACTTAAAGCTCTGTCATTGTTCAATGGGCTCAGAAAGCTC
TTCAAATAA

Protein

503 aa

>Os02t0725200-01 SET domain containing protein.
MATAAALALHTQFRPPRSPRRLRQHLALPSGVLIRSPVRASAASASASAPAQREAAAAGV
PWGCEIESLESAVSLERWLTDSGLPEQRLGIQRVDVGERGLVALKNIRKGEKLLFVPPSL
VITADSEWGCPEVGNVLKRNSVPDWPLIATYLISEASLESSSRWSSYIAALPRQPYSLLY
WTRPELDAYLVASPIRERAIQRITDVVGTYNDLRDRIFSKHSDLFPEEVYNLETFRWSFG
ILFSRLVRLPSMDGRVALVPWADMLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFI
SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESFP
LRVTGWPVELMAYAFLVVSPPEMSQRFEEMAVAASNKSPSKPGLNYPELEEQALQFILDC
CESNIAKYTKFLEGSSGSLQLSTNSKQANRTLLLKQLARDLCISERRILYRTQYILRRRL
RDMRGGELKALSLFNGLRKLFK*

5'UTR

chr02:30144260..30144312 (+ strand) : 53 bp

CDS

chr02:30144313..30144690 (+ strand) : 378 bp

chr02:30144822..30144985 (+ strand) : 164 bp

chr02:30145078..30145161 (+ strand) : 84 bp

chr02:30145244..30145301 (+ strand) : 58 bp

chr02:30145599..30145652 (+ strand) : 54 bp

chr02:30145817..30145888 (+ strand) : 72 bp

chr02:30146054..30146134 (+ strand) : 81 bp

chr02:30146868..30147040 (+ strand) : 173 bp

chr02:30147423..30147525 (+ strand) : 103 bp

chr02:30147655..30147786 (+ strand) : 132 bp

chr02:30147939..30148061 (+ strand) : 123 bp

chr02:30148158..30148244 (+ strand) : 87 bp

3'UTR

chr02:30148245..30148311 (+ strand) : 67 bp

chr02:30148391..30148692 (+ strand) : 302 bp

FASTA

>Os02t0725200-01 class=Sequence position=chr02:30144260..30148692 (+ strand)
GGATAAGCCC CCCGCGCCCG CACACAACCG CACCGCCATT TCGCGGTTCC GCCATGGCCA CCGCCGCGGC GCTCGCGCTC
CACACGCAGT TCCGGCCGCC GCGCTCGCCT CGCCGTCTCC GGCAGCATCT AGCCTTACCC TCAGGAGTCC TCATCCGATC
CCCCGTCCGC GCCTCGGCTG CGTCGGCGTC GGCGTCGGCG CCGGCGCAGC GGGAGGCCGC CGCCGCGGGA GTCCCGTGGG
GCTGCGAGAT CGAGTCCCTG GAGAGCGCCG TGTCGCTGGA GAGGTGGCTC ACCGATTCGG GGCTCCCCGA GCAGAGGTTG
GGGATACAGC GGGTGGACGT CGGTGAGCGC GGCCTCGTCG CGCTGAAGAA CATCCGCAAG GGGGAGAAGC TGCTCTTCGT
GCCTCCCTCC CTCGTCATTA CAGCTGACTC AGTAAGAAAG CCCTAGCCTC CCTCTCACTA GTCACTACCC CCGCTCGTTG
ATAGCTTTAA TGGTGGATTT CAGGTGCTTC ATGTGATGAA TTTACTGTCA ATTTGGTGAT TTTTGTTGTG CTTCTTGTAT
AGGAATGGGG CTGCCCTGAG GTGGGGAATG TGTTGAAGAG AAATTCTGTG CCGGATTGGC CGCTTATTGC TACCTACCTT
ATAAGCGAAG CTAGTTTAGA GAGTTCGTCG AGGTGGAGCA GCTACATAGC GGCGTTGCCA AGGCAGCCTT ACTCTCTGTT
GTACTGGTAT AGCCTGACGA TTATTGTTGA TGGGGGAAGT TCGGTGGGGC TTGGAGATTG CATTCTCAAT CTTGTACAGC
CTTTATTTGT TGTTGCAGGA CTAGGCCTGA GCTTGATGCA TACTTGGTGG CTTCGCCGAT CAGGGAACGC GCAATTCAGA
GGATCACTGA TGTGGTCGGA ACGTATGTTT TTTCTTTCTT TCTGCTGTAG TCCTGATGGT CATTTAGCCT TAATTGTAAA
ATCTTACTCT GTTGGTTTTG GCAGATACAA TGATCTCCGT GACAGAATAT TTTCTAAGCA TTCAGATTTG TTCCCTGAGG
AGGTATGTTT CACAAAAGTT AGTATGTTCT TTGTTGAGAC TAATGACACA AGAGGCCTTT CCGACCTAGA TTCTACTTTT
TAAGTCTCAG CAAGTTAAAA TATATAACAA GGCTAAGGAT TATATCATTC TTTAGCTTTC AGTACTAACA CAAAGATGTG
AAAGTGGTCT ACATACTACG CACTAAGAAA TGTACTGGTT CACTCACATG AGAGATATCA CATATTACTT CTAAAATATC
ATGTGTTTTT AGTGTAACCT GGTTGGTTTA TCTAATATAA CTTAACTTTA CTATTTTAGG TTTACAACTT AGAGACGTTT
AGATGGTCCT TCGGCATCCT CTTCTCACGC CTGGTAAGCT AAAGTACTAT GAACTTACCA AATGCAGTAA AAACATTTTT
TTTACTTCCA CCATGTATTC TCCAGTTACC TGTTTTGTTA CAAAATTGAA GGCTTTTGCA TTGCTTGCTG TTGATGTCAT
TCTGCTAAAC AAGAATGTTC ATTGGAATGA TTTGCAGGTT CGATTGCCAT CAATGGATGG AAGGGTTGCA CTAGTTCCTT
GGGCAGATAT GCTTAACCAT AGTCCTGAGG TTCGATTTGT ATGTTAGTAA CAAAGAATCA TTATGAATAG TGCACAGAAT
TCCTTAAGCA CTCTGTCTCC CATAGTTTTC ATTACTTGTA CAATTTCATA GGTCTTCATG ACATTCTTAT TGTTAGAGAT
TACTTCATAA GTTTTTTGCA AAATAAATTT TCAGGTGGAA ACATTCTTGG ATTATGATAA ATCCTCAGGG GGAATAGTTT
TCACTACCGA TCGTTCATAT CAACCAGGTG AGCAGGTAAC GCTTTTCATT TATGCTTTAG CCCTATATTG CTGTTTCAAG
ATTGGGGATT TTTAACTTAA CCTTGTGAAT ATGATAGCAA TTTTTTTTAC TGTTTCATTC AACTTACTTT ACGTCAAAAA
AAAATTATTA CGTCAAAAAA AATTCAACTT ACTAGGATCC TTGTTTTCTA CCAATAGATT GGTATCTCTG CCTATtacta
cctccggtca caaataagtg tcattctaga cagcaacaca gtcaccatta cagttgtttt atacaaatta ctagtataaa
actcataaaa tatatatcaa agttataata tttggaaact attttttgaa gatgaatcta accatatcac tttcaaaagt
tgaatcaaga tatttaaaga aattgatggt gacgattaaa gaaatattta aagagaacat gttgactgga cgcattccaa
aacgttactt atttgtgacc agagggagta GTAAGCAAAT CATCTTGAAT CTTGACACTA GTTTTAGGAT GCGTTCCCAA
AACATCTGGA GTTCATCCAT TTTATAAATT TTGTTTTGTG CAAACATAGC ATACTGTACT TAAGTGTGAT TCATGGAACA
TTTGGATCTG TCAGCCATCC TTTTCTTTAA AATGGAGTTA ATGAGATTTT TCTGTGGGTT ATGTCTAGGT GTAGTTATTT
CATGCAGTTA ACTCTTAAAC TTATCCGTTT CTAAAATATC CTCTTCAGGT GTTTATATCC TATGGCAAGA AATCCAGTGG
CGAGCTATTG CTTTCATATG GTTTTGTTCC AAAAGAGGGA ACAAACCCAA ATGATTCAGT TGAATTGCTG GTGTCTCTTA
ATAAGTCTGA TAAGTGCTAC AAAGAGAAGC TACAAGCACT AAAAAGAAAT GGATTGTCAG AGTAAGCGAT CATATCCTTG
CGTGCTAACA ACTCATAGTG AGTGAAAGAA AATGTTCTCT TAACTGTCGC GTTGTTGTGC CTTTATATCA TCTTGCTAAA
ATGAACATCC ATTAGACCTT AGGCTGGAGT ATTTTGTGGC ATGTTTGCTC TCTTATCGCC ATTTGAACAT GCCATCAAGA
ACGAAGTCTG AAAACAGTAT TTAGTTGTGT AACTGGTGTG GTCTGCAGAA GAAAAAAAAA TGAGTAAAAT TTCATAAATA
TTAGAATATG CAGTGTTGTT TCAACTCCCC TGCGATTATC TTACAGTGCA CATCTCTGTC ACTATCAAAT CGTACTTTTG
CTATCAATAT AAGTGGATCT GATCACTGAT TCATTACTTA CAGGTTTGAA AGTTTCCCTT TACGCGTCAC AGGATGGCCA
GTTGAGTTGA TGGCTTATGC CTTTCTTGTG GTCAGCCCTC CCGAGATGAG CCAACGTTTT GAAGAGGTTT GTCATTTCTG
TTTTGCACCG ATATTTCGGG ATCTTGTTGA CTGAGGTAAA ACTAGGGGTT TGTTGAAGAT AAATTGAGCT TACACTTATT
CTATATGAGT GATCTCCCAA AGCTTATCCT TTCAGATGGC TGTCGCTGCA TCAAATAAAA GTCCATCCAA GCCTGGACTT
AATTATCCTG AACTGGAGGA ACAAGCTCTT CAGTTTATCT TGGACTGTTG TGAGTCTAAC ATAGCAAAAT ACACAAAGTT
CCTAGAGGTG AGATCCTTTC CATGGAAGAT CTTGCAGAAC TTCTAGTTAA TTTATCGTGA TATTTAAACA GTACATTATG
CAAACTAGTT CTCTGATGAT CCTATGGATA CTTTTGTGAG TGCTAACAAA CTAATGTACG CCAATCAATA ATGTTTCAGG
GTAGCAGTGG GTCTCTGCAA CTTTCAACCA ATTCAAAGCA AGCCAACCGG ACGTTACTGC TAAAACAACT AGCAAGAGAT
CTTTGCATTA GTGAACGGAG AATCCTGTAT CGTACACAAT ATGTAAGTCA ATAATGCATG CTATATTGTT ACTTCTCTGT
GTTCATCATG TGGTTATTCT TAACTTCTTA CAAGTTACAA CCCTCTTTTT TCTTACAGAT ATTGCGTAGG AGACTGAGGG
ACATGAGAGG TGGTGAACTT AAAGCTCTGT CATTGTTCAA TGGGCTCAGA AAGCTCTTCA AATAAAAGGA TGGATTTGTT
TTTCAATGTT AGCTGAAGAT TTCGAGGACA ATGTTTAATC TCTAGTATCT TGGTAATTCT CAATATATCT CATGTTAAGC
CACTTTCAGC TGTTGGATAC CATATTACTG ACTGGGCACT ATATTCTGCA GCTTCTTCCT TTCAGGTTGT CTTTGTTGCT
GATGAAGCTC AGACTGTTGA AGAAAAGGAA ATTGACAAAT CAGATTACAA TCTCAGCCGA CAAGCAACTG ATGCTAGAAG
ACTAGAAGTG GTCACAGCTC AATAGAAGAC ACTAGTTGTA ACTTGCGATT GAACAGTCCA TATCTTGGTT TAAATCTACT
ATAGCACCAT GCAACAATGT ACCAGTGGAG TCATCTCGTG TATATTTTGT TTCAGGGGTT TCCCCTCGAT ATCTATAGCA
TAATATCCCT TCTATTTCTG CTGTTTTCAC CCC

Locus: Os02g0725200

Loading...

Locus: Os02g0725200

Loading...