Os02t0725200-02

Locus

Os02g0725200

Description

Similar to Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit N-methyltransferase I.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET12

Oryzabase Gene Name Synonym(s)

SET protein 12

Transcript Evidence

AK058309 (DDBJ, Best hit)

Protein Evidence

B6U6Z1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Rubisco LS methyltransferase, substrate-binding domain (IPR015353)

Full-length cDNA

001-013-H08 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725200-02)

RiceXPro (AK058309)

Others

Oryzabase (13378)

KEGG (Os02t0725200-02)

Transcript

1357 bp

>Os02t0725200-02 Similar to Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit N-methyltransferase I.
ATAGCGGCGTTGCCAAGGCAGCCTTACTCTCTGTTGTACTGGACTAGGCCTGAGCTTGAT
GCATACTTGGTGGCTTCGCCGATCAGGGAACGCGCAATTCAGAGGATCACTGATGTGGTC
GGAACATACAATGATCTCCGTGACAGAATATTTTCTAAGCATTCAGATTTGTTCCCTGAG
GAGGTTTACAACTTAGAGACGTTTAGATGGTCCTTCGGCATCCTCTTCTCACGCCTGGTT
CGATTGCCATCAATGGATGGAAGGGTTGCACTAGTTCCTTGGGCAGATATGCTTAACCAT
AGTCCTGAGGTGGAAACATTCTTGGATTATGATAAATCCTCAGGGGGAATAGTTTTCACT
ACCGATCGTTCATATCAACCAGGTGAGCAGGTGTTTATATCCTATGGCAAGAAATCCAGT
GGCGAGCTATTGCTTTCATATGGTTTTGTTCCAAAAGAGGGAACAAACCCAAATGATTCA
GTTGAATTGCTGGTGTCTCTTAATAAGTCTGATAAGTGCTACAAAGAGAAGCTACAAGCA
CTAAAAAGAAATGGATTGTCAGAGTTTGAAAGTTTCCCTTTACGCGTCACAGGATGGCCA
GTTGAGTTGATGGCTTATGCCTTTCTTGTGGTCAGCCCTCCCGAGATGAGCCAACGTTTT
GAAGAGATGGCTGTCGCTGCATCAAATAAAAGTCCATCCAAGCCTGGACTTAATTATCCT
GAACTGGAGGAACAAGCTCTTCAGTTTATCTTGGACTGTTGTGAGTCTAACATAGCAAAA
TACACAAAGTTCCTAGAGGGTAGCAGTGGGTCTCTGCAACTTTCAACCAATTCAAAGCAA
GCCAACCGGACGTTACTGCTAAAACAACTAGCAAGAGATCTTTGCATTAGTGAACGGAGA
ATCCTGTATCGTACACAATATATATTGCGTAGGAGACTGAGGGACATGAGAGGTGGTGAA
CTTAAAGCTCTGTCATTGTTCAATGGGCTCAGAAAGCTCTTCAAATAAAAGGATGGATTT
GTTTTTCAATGTTAGCTGAAGATTTCGAGGACAATGTTTAATCTCTAGTATCTTGCTTCT
TCCTTTCAGGTTGTCTTTGTTGCTGATGAAGCTCAGACTGTTGAAGAAAAGGAAATTGAC
AAATCAGATTACAATCTCAGCCGACAAGCAACTGATGCTAGAAGACTAGAAGTGGTCACA
GCTCAATAGAAGACACTAGTTGTAACTTGCGATTGAACAGTCCATATCTTGGTTTAAATC
TACTATAGCACCATGCAACAATGTACCAGTGGAGTCATCTCGTGTATATTTTGTTTCAGG
GGTTTCCCCTCGATATCTATAGCATAATATCCCTTCT

CDS

1008 bp

>Os02t0725200-02 Similar to Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit N-methyltransferase I.
ATAGCGGCGTTGCCAAGGCAGCCTTACTCTCTGTTGTACTGGACTAGGCCTGAGCTTGAT
GCATACTTGGTGGCTTCGCCGATCAGGGAACGCGCAATTCAGAGGATCACTGATGTGGTC
GGAACATACAATGATCTCCGTGACAGAATATTTTCTAAGCATTCAGATTTGTTCCCTGAG
GAGGTTTACAACTTAGAGACGTTTAGATGGTCCTTCGGCATCCTCTTCTCACGCCTGGTT
CGATTGCCATCAATGGATGGAAGGGTTGCACTAGTTCCTTGGGCAGATATGCTTAACCAT
AGTCCTGAGGTGGAAACATTCTTGGATTATGATAAATCCTCAGGGGGAATAGTTTTCACT
ACCGATCGTTCATATCAACCAGGTGAGCAGGTGTTTATATCCTATGGCAAGAAATCCAGT
GGCGAGCTATTGCTTTCATATGGTTTTGTTCCAAAAGAGGGAACAAACCCAAATGATTCA
GTTGAATTGCTGGTGTCTCTTAATAAGTCTGATAAGTGCTACAAAGAGAAGCTACAAGCA
CTAAAAAGAAATGGATTGTCAGAGTTTGAAAGTTTCCCTTTACGCGTCACAGGATGGCCA
GTTGAGTTGATGGCTTATGCCTTTCTTGTGGTCAGCCCTCCCGAGATGAGCCAACGTTTT
GAAGAGATGGCTGTCGCTGCATCAAATAAAAGTCCATCCAAGCCTGGACTTAATTATCCT
GAACTGGAGGAACAAGCTCTTCAGTTTATCTTGGACTGTTGTGAGTCTAACATAGCAAAA
TACACAAAGTTCCTAGAGGGTAGCAGTGGGTCTCTGCAACTTTCAACCAATTCAAAGCAA
GCCAACCGGACGTTACTGCTAAAACAACTAGCAAGAGATCTTTGCATTAGTGAACGGAGA
ATCCTGTATCGTACACAATATATATTGCGTAGGAGACTGAGGGACATGAGAGGTGGTGAA
CTTAAAGCTCTGTCATTGTTCAATGGGCTCAGAAAGCTCTTCAAATAA

Protein

336 aa

>Os02t0725200-02 Similar to Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit N-methyltransferase I.
IAALPRQPYSLLYWTRPELDAYLVASPIRERAIQRITDVVGTYNDLRDRIFSKHSDLFPE
EVYNLETFRWSFGILFSRLVRLPSMDGRVALVPWADMLNHSPEVETFLDYDKSSGGIVFT
TDRSYQPGEQVFISYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQA
LKRNGLSEFESFPLRVTGWPVELMAYAFLVVSPPEMSQRFEEMAVAASNKSPSKPGLNYP
ELEEQALQFILDCCESNIAKYTKFLEGSSGSLQLSTNSKQANRTLLLKQLARDLCISERR
ILYRTQYILRRRLRDMRGGELKALSLFNGLRKLFK*

CDS

chr02:30144945..30144985 (+ strand) : 41 bp

chr02:30145078..30145161 (+ strand) : 84 bp

chr02:30145244..30145301 (+ strand) : 58 bp

chr02:30145599..30145652 (+ strand) : 54 bp

chr02:30145817..30145888 (+ strand) : 72 bp

chr02:30146054..30146134 (+ strand) : 81 bp

chr02:30146868..30147040 (+ strand) : 173 bp

chr02:30147423..30147525 (+ strand) : 103 bp

chr02:30147655..30147786 (+ strand) : 132 bp

chr02:30147939..30148061 (+ strand) : 123 bp

chr02:30148158..30148244 (+ strand) : 87 bp

3'UTR

chr02:30148245..30148311 (+ strand) : 67 bp

chr02:30148391..30148672 (+ strand) : 282 bp

FASTA

>Os02t0725200-02 class=Sequence position=chr02:30144945..30148672 (+ strand)
ATAGCGGCGT TGCCAAGGCA GCCTTACTCT CTGTTGTACT GGTATAGCCT GACGATTATT GTTGATGGGG GAAGTTCGGT
GGGGCTTGGA GATTGCATTC TCAATCTTGT ACAGCCTTTA TTTGTTGTTG CAGGACTAGG CCTGAGCTTG ATGCATACTT
GGTGGCTTCG CCGATCAGGG AACGCGCAAT TCAGAGGATC ACTGATGTGG TCGGAACGTA TGTTTTTTCT TTCTTTCTGC
TGTAGTCCTG ATGGTCATTT AGCCTTAATT GTAAAATCTT ACTCTGTTGG TTTTGGCAGA TACAATGATC TCCGTGACAG
AATATTTTCT AAGCATTCAG ATTTGTTCCC TGAGGAGGTA TGTTTCACAA AAGTTAGTAT GTTCTTTGTT GAGACTAATG
ACACAAGAGG CCTTTCCGAC CTAGATTCTA CTTTTTAAGT CTCAGCAAGT TAAAATATAT AACAAGGCTA AGGATTATAT
CATTCTTTAG CTTTCAGTAC TAACACAAAG ATGTGAAAGT GGTCTACATA CTACGCACTA AGAAATGTAC TGGTTCACTC
ACATGAGAGA TATCACATAT TACTTCTAAA ATATCATGTG TTTTTAGTGT AACCTGGTTG GTTTATCTAA TATAACTTAA
CTTTACTATT TTAGGTTTAC AACTTAGAGA CGTTTAGATG GTCCTTCGGC ATCCTCTTCT CACGCCTGGT AAGCTAAAGT
ACTATGAACT TACCAAATGC AGTAAAAACA TTTTTTTTAC TTCCACCATG TATTCTCCAG TTACCTGTTT TGTTACAAAA
TTGAAGGCTT TTGCATTGCT TGCTGTTGAT GTCATTCTGC TAAACAAGAA TGTTCATTGG AATGATTTGC AGGTTCGATT
GCCATCAATG GATGGAAGGG TTGCACTAGT TCCTTGGGCA GATATGCTTA ACCATAGTCC TGAGGTTCGA TTTGTATGTT
AGTAACAAAG AATCATTATG AATAGTGCAC AGAATTCCTT AAGCACTCTG TCTCCCATAG TTTTCATTAC TTGTACAATT
TCATAGGTCT TCATGACATT CTTATTGTTA GAGATTACTT CATAAGTTTT TTGCAAAATA AATTTTCAGG TGGAAACATT
CTTGGATTAT GATAAATCCT CAGGGGGAAT AGTTTTCACT ACCGATCGTT CATATCAACC AGGTGAGCAG GTAACGCTTT
TCATTTATGC TTTAGCCCTA TATTGCTGTT TCAAGATTGG GGATTTTTAA CTTAACCTTG TGAATATGAT AGCAATTTTT
TTTACTGTTT CATTCAACTT ACTTTACGTC AAAAAAAAAT TATTACGTCA AAAAAAATTC AACTTACTAG GATCCTTGTT
TTCTACCAAT AGATTGGTAT CTCTGCCTAT tactacctcc ggtcacaaat aagtgtcatt ctagacagca acacagtcac
cattacagtt gttttataca aattactagt ataaaactca taaaatatat atcaaagtta taatatttgg aaactatttt
ttgaagatga atctaaccat atcactttca aaagttgaat caagatattt aaagaaattg atggtgacga ttaaagaaat
atttaaagag aacatgttga ctggacgcat tccaaaacgt tacttatttg tgaccagagg gagtaGTAAG CAAATCATCT
TGAATCTTGA CACTAGTTTT AGGATGCGTT CCCAAAACAT CTGGAGTTCA TCCATTTTAT AAATTTTGTT TTGTGCAAAC
ATAGCATACT GTACTTAAGT GTGATTCATG GAACATTTGG ATCTGTCAGC CATCCTTTTC TTTAAAATGG AGTTAATGAG
ATTTTTCTGT GGGTTATGTC TAGGTGTAGT TATTTCATGC AGTTAACTCT TAAACTTATC CGTTTCTAAA ATATCCTCTT
CAGGTGTTTA TATCCTATGG CAAGAAATCC AGTGGCGAGC TATTGCTTTC ATATGGTTTT GTTCCAAAAG AGGGAACAAA
CCCAAATGAT TCAGTTGAAT TGCTGGTGTC TCTTAATAAG TCTGATAAGT GCTACAAAGA GAAGCTACAA GCACTAAAAA
GAAATGGATT GTCAGAGTAA GCGATCATAT CCTTGCGTGC TAACAACTCA TAGTGAGTGA AAGAAAATGT TCTCTTAACT
GTCGCGTTGT TGTGCCTTTA TATCATCTTG CTAAAATGAA CATCCATTAG ACCTTAGGCT GGAGTATTTT GTGGCATGTT
TGCTCTCTTA TCGCCATTTG AACATGCCAT CAAGAACGAA GTCTGAAAAC AGTATTTAGT TGTGTAACTG GTGTGGTCTG
CAGAAGAAAA AAAAATGAGT AAAATTTCAT AAATATTAGA ATATGCAGTG TTGTTTCAAC TCCCCTGCGA TTATCTTACA
GTGCACATCT CTGTCACTAT CAAATCGTAC TTTTGCTATC AATATAAGTG GATCTGATCA CTGATTCATT ACTTACAGGT
TTGAAAGTTT CCCTTTACGC GTCACAGGAT GGCCAGTTGA GTTGATGGCT TATGCCTTTC TTGTGGTCAG CCCTCCCGAG
ATGAGCCAAC GTTTTGAAGA GGTTTGTCAT TTCTGTTTTG CACCGATATT TCGGGATCTT GTTGACTGAG GTAAAACTAG
GGGTTTGTTG AAGATAAATT GAGCTTACAC TTATTCTATA TGAGTGATCT CCCAAAGCTT ATCCTTTCAG ATGGCTGTCG
CTGCATCAAA TAAAAGTCCA TCCAAGCCTG GACTTAATTA TCCTGAACTG GAGGAACAAG CTCTTCAGTT TATCTTGGAC
TGTTGTGAGT CTAACATAGC AAAATACACA AAGTTCCTAG AGGTGAGATC CTTTCCATGG AAGATCTTGC AGAACTTCTA
GTTAATTTAT CGTGATATTT AAACAGTACA TTATGCAAAC TAGTTCTCTG ATGATCCTAT GGATACTTTT GTGAGTGCTA
ACAAACTAAT GTACGCCAAT CAATAATGTT TCAGGGTAGC AGTGGGTCTC TGCAACTTTC AACCAATTCA AAGCAAGCCA
ACCGGACGTT ACTGCTAAAA CAACTAGCAA GAGATCTTTG CATTAGTGAA CGGAGAATCC TGTATCGTAC ACAATATGTA
AGTCAATAAT GCATGCTATA TTGTTACTTC TCTGTGTTCA TCATGTGGTT ATTCTTAACT TCTTACAAGT TACAACCCTC
TTTTTTCTTA CAGATATTGC GTAGGAGACT GAGGGACATG AGAGGTGGTG AACTTAAAGC TCTGTCATTG TTCAATGGGC
TCAGAAAGCT CTTCAAATAA AAGGATGGAT TTGTTTTTCA ATGTTAGCTG AAGATTTCGA GGACAATGTT TAATCTCTAG
TATCTTGGTA ATTCTCAATA TATCTCATGT TAAGCCACTT TCAGCTGTTG GATACCATAT TACTGACTGG GCACTATATT
CTGCAGCTTC TTCCTTTCAG GTTGTCTTTG TTGCTGATGA AGCTCAGACT GTTGAAGAAA AGGAAATTGA CAAATCAGAT
TACAATCTCA GCCGACAAGC AACTGATGCT AGAAGACTAG AAGTGGTCAC AGCTCAATAG AAGACACTAG TTGTAACTTG
CGATTGAACA GTCCATATCT TGGTTTAAAT CTACTATAGC ACCATGCAAC AATGTACCAG TGGAGTCATC TCGTGTATAT
TTTGTTTCAG GGGTTTCCCC TCGATATCTA TAGCATAATA TCCCTTCT

Locus: Os02g0725200

Loading...

Locus: Os02g0725200

Loading...