Os02t0725300-01

Locus

Os02g0725300

Description

Cellulose synthase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLE2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE E2

Oryzabase Gene Symbol Synonym(s)

OsCslE2, OsCSLE2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK101487 (DDBJ, Best hit)

Protein Evidence

Q0DXZ1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

J033042D19 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725300-01)

RiceXPro (AK101487)

Others

Oryzabase (13898)

KEGG (Os02t0725300-01)

Transcript

2345 bp

>Os02t0725300-01 Cellulose synthase family protein.
ACCCACTCCTCTGAAGTCCCAGTGCCATCTGCTCCATACTTCGCAGGTAGGAGGGAGCAT
GGCGGGGAGCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTCGC
GACGGAGAAACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTCTT
CGCGGGAGTTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGCGA
CGGCGTGCGGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTCTA
CTGGGTCCTGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGACCG
CCTCGCTCAAAGCTACAGTGAAGACGAGCTTCCCAGTGTGGACATTTTTGTCTGTACAGC
GGATCCAACAGCAGAGCCACCGATGCTTGTCATCTCCACTGTTTTGTCTGTCATGGCTTA
TGACTACCTGCCTGAGAAGCTGAACATCTACTTATCTGATGATGCTGGTTCGGTTTTAAC
ATTCTACGTTCTATGCGAGGCATCCGAGTTTGCAAAGCATTGGATTCCATTTTGCAAGAA
GTACAAGGTGGAACCCAGATCACCAGCTGCTTACTTTGCTAAAGTAGCTTCCCCTCCTGA
TGGGTGTGGACCTAAAGAGTGGTTTACCATGAAGGAACTGTACAAAGACATGACAGATCG
TGTGAACTCAGTAGTAAATTCAGGTAGGATCCCCGAGGTTCCACGATGCCATTCCAGAGG
CTTCTCACAGTGGAATGAGAATTTCACTTCTAGTGATCACCCTTCTATAGTTCAGATTTT
AATCGATAGTAACAAACAAAAGGCAGTTGATATTGATGGAAATGCATTGCCAACACTTGT
ATATATGGCACGTGAGAAGAAACCCCAGAAACAGCATCACTTCAAAGCTGGATCTTTGAA
TGCTTTGATAAGGGTATCATCAGTGATAAGCAACAGTCCAATCATCATGAATGTTGATTG
TGATATGTACTCAAACAATTCAGAGTCCATCAGAGACGCATTGTGTTTTTTCCTAGATGA
AGAGCAAGGCCAAGATATTGGTTTTGTACAGTATCCTCAGAATTTTGAAAATGTGGTGCA
CAATGACATCTATGGCCACCCAATCAATGTTGTCAACGAGTTGGATCATCCTTGCTTGGA
TGGTTGGGGTGGAATGTGTTACTATGGCACTGGATGCTTCCATCGGAGAGAGGCCCTATG
TGGACGAATCTATAGTCAAGAATATAAGGAAGATTGGACTAGGGTAGCAGGGAGAACAGA
AGATGCTAATGAGTTGGAAGAAATGGGCAGGTCACTTGTGACTTGCACATATGAGCATAA
CACCATCTGGGGAATTGAGAAGGGGGTTAGGTATGGGTGCCCACTGGAGGATGTAACTAC
AGGATTACAAATCCAATGCCGTGGATGGAGATCAGTGTACTACAACCCCAAAAGAAAGGG
ATTCTTAGGCATGACACCCACCTCACTAGGCCAGATCCTGGTCCTGTACAAGAGATGGAC
AGAAGGGTTCCTCCAAATATCCCTCTCACGGTACAGCCCCTTCTTATTAGGTCATGGGAA
GATCAAGCTGGGTCTTCAAATGGGCTACTCTGTCTGCGGCTTCTGGGCCGTGAACAGCTT
CCCCACCTTGTACTATGTCACAATTCCTTCTCTTTGCTTCCTCAATGGCATCTCCCTCTT
TCCTGAGAAAACTAGCCCCTGGTTCATACCCTTTGCGTACGTTATGGTGGCCGCATACTC
CTGCAGCTTAGCAGAGTCACTGCAATGTGGTGACAGTGCAGTGGAGTGGTGGAATGCACA
GAGGATGTGGCTCATTAGAAGGATCACCTCATACCTCCTGGCAACCATCGACACATTCCG
CAGAATATTGGGCATCTCTGAGTCTGGATTCAACCTGACAGTGAAGGTCACTGACTTGCA
GGCCTTGGAGAGGTACAAGAAGGGGATGATGGAATTCGGATCCTTCTCGGCGATGTTTGT
AATCCTTACGACAGTTGCGCTGCTCAACCTGGCATGCATGGTGTTAGGAATTAGTAGAGT
TTTGTTACAAGAAGGCCCAGGGGGTTTGGAAACTTTGTTTCTCCAGGCTGTTCTGTGTGT
ACTGATAGTAGCCATCAATTCTCCGGTTTATGAGGCGCTCTTCCTCCGCAGGGACAAGGG
CAGCTTGCCAGCTTCTGTCGCTCGAGTTTCCATTTGCTTTGTGTTGCCACTCTGTATACT
CTCAATATGTAAATGATATTACGTACAGTATGTACAATGCTATATATCAGGAAGAAATTA
AACTT

CDS

2238 bp

>Os02t0725300-01 Cellulose synthase family protein.
ATGGCGGGGAGCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTC
GCGACGGAGAAACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTC
TTCGCGGGAGTTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGC
GACGGCGTGCGGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTC
TACTGGGTCCTGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGAC
CGCCTCGCTCAAAGCTACAGTGAAGACGAGCTTCCCAGTGTGGACATTTTTGTCTGTACA
GCGGATCCAACAGCAGAGCCACCGATGCTTGTCATCTCCACTGTTTTGTCTGTCATGGCT
TATGACTACCTGCCTGAGAAGCTGAACATCTACTTATCTGATGATGCTGGTTCGGTTTTA
ACATTCTACGTTCTATGCGAGGCATCCGAGTTTGCAAAGCATTGGATTCCATTTTGCAAG
AAGTACAAGGTGGAACCCAGATCACCAGCTGCTTACTTTGCTAAAGTAGCTTCCCCTCCT
GATGGGTGTGGACCTAAAGAGTGGTTTACCATGAAGGAACTGTACAAAGACATGACAGAT
CGTGTGAACTCAGTAGTAAATTCAGGTAGGATCCCCGAGGTTCCACGATGCCATTCCAGA
GGCTTCTCACAGTGGAATGAGAATTTCACTTCTAGTGATCACCCTTCTATAGTTCAGATT
TTAATCGATAGTAACAAACAAAAGGCAGTTGATATTGATGGAAATGCATTGCCAACACTT
GTATATATGGCACGTGAGAAGAAACCCCAGAAACAGCATCACTTCAAAGCTGGATCTTTG
AATGCTTTGATAAGGGTATCATCAGTGATAAGCAACAGTCCAATCATCATGAATGTTGAT
TGTGATATGTACTCAAACAATTCAGAGTCCATCAGAGACGCATTGTGTTTTTTCCTAGAT
GAAGAGCAAGGCCAAGATATTGGTTTTGTACAGTATCCTCAGAATTTTGAAAATGTGGTG
CACAATGACATCTATGGCCACCCAATCAATGTTGTCAACGAGTTGGATCATCCTTGCTTG
GATGGTTGGGGTGGAATGTGTTACTATGGCACTGGATGCTTCCATCGGAGAGAGGCCCTA
TGTGGACGAATCTATAGTCAAGAATATAAGGAAGATTGGACTAGGGTAGCAGGGAGAACA
GAAGATGCTAATGAGTTGGAAGAAATGGGCAGGTCACTTGTGACTTGCACATATGAGCAT
AACACCATCTGGGGAATTGAGAAGGGGGTTAGGTATGGGTGCCCACTGGAGGATGTAACT
ACAGGATTACAAATCCAATGCCGTGGATGGAGATCAGTGTACTACAACCCCAAAAGAAAG
GGATTCTTAGGCATGACACCCACCTCACTAGGCCAGATCCTGGTCCTGTACAAGAGATGG
ACAGAAGGGTTCCTCCAAATATCCCTCTCACGGTACAGCCCCTTCTTATTAGGTCATGGG
AAGATCAAGCTGGGTCTTCAAATGGGCTACTCTGTCTGCGGCTTCTGGGCCGTGAACAGC
TTCCCCACCTTGTACTATGTCACAATTCCTTCTCTTTGCTTCCTCAATGGCATCTCCCTC
TTTCCTGAGAAAACTAGCCCCTGGTTCATACCCTTTGCGTACGTTATGGTGGCCGCATAC
TCCTGCAGCTTAGCAGAGTCACTGCAATGTGGTGACAGTGCAGTGGAGTGGTGGAATGCA
CAGAGGATGTGGCTCATTAGAAGGATCACCTCATACCTCCTGGCAACCATCGACACATTC
CGCAGAATATTGGGCATCTCTGAGTCTGGATTCAACCTGACAGTGAAGGTCACTGACTTG
CAGGCCTTGGAGAGGTACAAGAAGGGGATGATGGAATTCGGATCCTTCTCGGCGATGTTT
GTAATCCTTACGACAGTTGCGCTGCTCAACCTGGCATGCATGGTGTTAGGAATTAGTAGA
GTTTTGTTACAAGAAGGCCCAGGGGGTTTGGAAACTTTGTTTCTCCAGGCTGTTCTGTGT
GTACTGATAGTAGCCATCAATTCTCCGGTTTATGAGGCGCTCTTCCTCCGCAGGGACAAG
GGCAGCTTGCCAGCTTCTGTCGCTCGAGTTTCCATTTGCTTTGTGTTGCCACTCTGTATA
CTCTCAATATGTAAATGA

Protein

746 aa

>Os02t0725300-01 Cellulose synthase family protein.
MAGSGGGVVSGGRQRGPPLFATEKPGRMAMAAYRVSAATVFAGVLLIWLYRATHLPPGGG
DGVRRWAWLGMLAAELWFGFYWVLTLSVRWCPVYRRTFKDRLAQSYSEDELPSVDIFVCT
ADPTAEPPMLVISTVLSVMAYDYLPEKLNIYLSDDAGSVLTFYVLCEASEFAKHWIPFCK
KYKVEPRSPAAYFAKVASPPDGCGPKEWFTMKELYKDMTDRVNSVVNSGRIPEVPRCHSR
GFSQWNENFTSSDHPSIVQILIDSNKQKAVDIDGNALPTLVYMAREKKPQKQHHFKAGSL
NALIRVSSVISNSPIIMNVDCDMYSNNSESIRDALCFFLDEEQGQDIGFVQYPQNFENVV
HNDIYGHPINVVNELDHPCLDGWGGMCYYGTGCFHRREALCGRIYSQEYKEDWTRVAGRT
EDANELEEMGRSLVTCTYEHNTIWGIEKGVRYGCPLEDVTTGLQIQCRGWRSVYYNPKRK
GFLGMTPTSLGQILVLYKRWTEGFLQISLSRYSPFLLGHGKIKLGLQMGYSVCGFWAVNS
FPTLYYVTIPSLCFLNGISLFPEKTSPWFIPFAYVMVAAYSCSLAESLQCGDSAVEWWNA
QRMWLIRRITSYLLATIDTFRRILGISESGFNLTVKVTDLQALERYKKGMMEFGSFSAMF
VILTTVALLNLACMVLGISRVLLQEGPGGLETLFLQAVLCVLIVAINSPVYEALFLRRDK
GSLPASVARVSICFVLPLCILSICK*

5'UTR

chr02:30148858..30148915 (+ strand) : 58 bp

CDS

chr02:30148916..30149229 (+ strand) : 314 bp

chr02:30149444..30149765 (+ strand) : 322 bp

chr02:30151480..30151620 (+ strand) : 141 bp

chr02:30151859..30151990 (+ strand) : 132 bp

chr02:30152096..30152308 (+ strand) : 213 bp

chr02:30152408..30152626 (+ strand) : 219 bp

chr02:30152779..30153126 (+ strand) : 348 bp

chr02:30153218..30153766 (+ strand) : 549 bp

3'UTR

chr02:30153767..30153815 (+ strand) : 49 bp

FASTA

>Os02t0725300-01 class=Sequence position=chr02:30148858..30153815 (+ strand)
ACCCACTCCT CTGAAGTCCC AGTGCCATCT GCTCCATACT TCGCAGGTAG GAGGGAGCAT GGCGGGGAGC GGCGGCGGCG
TCGTCTCCGG CGGCCGCCAG CGCGGGCCCC CGCTGTTCGC GACGGAGAAA CCGGGGCGGA TGGCGATGGC GGCGTACCGG
GTGTCCGCGG CCACGGTCTT CGCGGGAGTT CTTCTGATAT GGCTGTACAG AGCCACTCAC CTGCCTCCCG GTGGCGGCGA
CGGCGTGCGG CGGTGGGCGT GGCTCGGGAT GCTCGCGGCG GAGCTCTGGT TCGGCTTCTA CTGGGTCCTG ACGCTGTCCG
TGCGGTGGTG CCCCGTCTAC CGCCGCACCT TCAAAGACCG CCTCGCTCAA AGGTACCTCC CGGCTCTCGA TAGTACCAGC
AACTGCTATC AAGGTTAATC TGTGTCGCAA TTCCTTCTCC TTGCTTGGTT TGTTCTTTCA TTGGATATGT ACTGATTATC
CTTTGCTCAA AAAAGATATG TAGTATTGAT TACGTTTGCT CAAAAAGGAT ATGTAGAATT GTTGTTGAAA GACATGCTAT
GATGCTAGAA TTTTGATTGC AAACAGCTAC AGTGAAGACG AGCTTCCCAG TGTGGACATT TTTGTCTGTA CAGCGGATCC
AACAGCAGAG CCACCGATGC TTGTCATCTC CACTGTTTTG TCTGTCATGG CTTATGACTA CCTGCCTGAG AAGCTGAACA
TCTACTTATC TGATGATGCT GGTTCGGTTT TAACATTCTA CGTTCTATGC GAGGCATCCG AGTTTGCAAA GCATTGGATT
CCATTTTGCA AGAAGTACAA GGTGGAACCC AGATCACCAG CTGCTTACTT TGCTAAAGTA GCTTCCCCTC CTGATGGGTG
TGGACCTAAA GAGTGGTTTA CCATGAAGGT AGAGTTGAAA CTGTTGTGAT GTAATGTAGT TCATCTTCAA CTAAATTGCT
GTTGTGCACT ATTACTTTTT TTTCGCCGGG AAGGCCGAAG GAGGCCATCC Aaatatatta agaaggagta aaagttacaa
gaaaaaaaaa acatcacaat gcaccaaggt gcatgacctc acagcacgca ctaccaccca agcacaaacc gctgagggtg
aagcctagca ccaaatgacc cccgctaaga atggccgaac gccgctaggc ctacggcaac accacagaga caagactccg
aaaacgaagc caccacggtg gtcacgacat ccaggatgcc gccatcgccc atctaaaaaa gatgtggttt tcacccagag
aagcttatcg agaaaggaag agggtaaccc ttgacaacgc cccaaggagg ttacgacgcc cgaagacata gccgctgccg
gcccagtgaa ttaccggact aggcttttgc ctgggaccct acaaccttga ctgtagatcg ccgtccacca actcagaacc
actacacaga caaatggcaa cacgtagctt ccaccacacc gcactgacgc ccctccatcg accgacttca tcgaaccaca
ccgcactgac gcccctccgt cagccgacat caaccaccgc ccctgagagc tggcccagga cccctccgtt ccaccacccg
ccggcctcct cgccagcttt ggacaaaagg agaaccggga ctggatggca ttgctttggc agcctgagtt tcccccgctt
gacgagctgc cgcctcaatc caacatagaa actccccaca gagaagggga ggagctccag gaagggcgag ggtgccgacc
ggcaacggag aagacgaccc accgccgcca gctcccttta cactgccatc tgggcttgcg ccgacgccag agacgcttct
gctgctccgg ctccggcgca acccaccggc gcccccgtcg cccggccgcc gcaccccatc tggccgcgcc gcatagccca
cccggctgag gagggcaccg cggcgtcacc ctggctgccc ggctgccgag gcctgcctgc gccatggggg ctcgccgccg
cactgccgag ccgcgcgagc ccgggctgcc cggaccggcc gcgcgccgag ctgccgccgc cgctcccagc cgccgccgcc
tctaggcagc cgccatccca gccgtcgagc caccgccacc gcgcccaggc tgccgcaccg ggccagccgc gccgtccctg
ccgccgctgc cgccgccccc ccagccacct cgcgccgccg ttgtgccaga tccaggcgtg gggtggtcgg atccggcctt
ggaggcgccg gatctgctgc ctccccacac cgcgccgcca tcgccacctc cggccgcggt ggagggtctt cgccggcgtc
gtcgtcccgt ccacgtcacg ccggggggag tcgccgggag gaagaacctc gccgccgcct tccctgctcg ctgccggctt
tgccgccggc gagctccggc ggcggcgagg cggtggggag ggagtggagg cgtgggcggc tagggttttt tcgccccctg
agccacccgc gcgagagcga cgCGAGAGGT TGTTTTCAGG TTATCAATTT AGTCTGTGCA CTATTACTGG CTTCCATTTG
GTGCACTACT AGTGATTTAC ATGTCTACTT ATTACCTTTA CTTTCTTTTT TCTGTGTTTC AGGAACTGTA CAAAGACATG
ACAGATCGTG TGAACTCAGT AGTAAATTCA GGTAGGATCC CCGAGGTTCC ACGATGCCAT TCCAGAGGCT TCTCACAGTG
GAATGAGAAT TTCACTTCTA GTGATCACCC TTCTATAGTT CAGGTAAAAG TTATGTGGTG ATGACCAGGT TAACAGATGA
AGAACATTTA ATTGAATTCA AAATTCAGAA TAATGAGATG ATTAGAAAAT TTTAAAACAA AGCTGGTGTG TTGGCTCTAA
TCATAATTGC TAACATATAA GAATGTACAT GCACAAGAAA CTTTAATGGG ATATGAAATT TGTTTTTCTT GTCTGCAACA
TATTTGTGGA TTCTGCTGAT CAAAGTGTTC TCCATGGCTA GATTTTAATC GATAGTAACA AACAAAAGGC AGTTGATATT
GATGGAAATG CATTGCCAAC ACTTGTATAT ATGGCACGTG AGAAGAAACC CCAGAAACAG CATCACTTCA AAGCTGGATC
TTTGAATGCT TTGGTGGGTC TTTTAGCCAC TCTATGGTCC ATGATTTTCT ACCGCAACAA TTTAGAGTCA ACCTTATCGT
GTTTCTAGAA TTCCTTAAAT TATGGTCAAT ATTTGCAGAT AAGGGTATCA TCAGTGATAA GCAACAGTCC AATCATCATG
AATGTTGATT GTGATATGTA CTCAAACAAT TCAGAGTCCA TCAGAGACGC ATTGTGTTTT TTCCTAGATG AAGAGCAAGG
CCAAGATATT GGTTTTGTAC AGTATCCTCA GAATTTTGAA AATGTGGTGC ACAATGACAT CTATGGCCAC CCAATCAATG
TTGTCAACGA GGTCAGTAGT AAGATAGCAT AGCATCTCCT GAAATTTCAG TGGACATACT TACACAATTG GACCTAACTT
TGTTTGTGAT TTCATTCCGT TGATCACCAG TTGGATCATC CTTGCTTGGA TGGTTGGGGT GGAATGTGTT ACTATGGCAC
TGGATGCTTC CATCGGAGAG AGGCCCTATG TGGACGAATC TATAGTCAAG AATATAAGGA AGATTGGACT AGGGTAGCAG
GGAGAACAGA AGATGCTAAT GAGTTGGAAG AAATGGGCAG GTCACTTGTG ACTTGCACAT ATGAGCATAA CACCATCTGG
GGAATTGAGG TATGTTAGTC TCTTACTTCA TACCCTGAAC ATGTAAACTG TTGGATTTTA TCCTCTATAG CCATCAACCA
GCAATGGGCA TTCGCATAGT TACAGAACTT TGTTCATTTT GTACTGATTA CAGCTACTGA CTTCAAGTTG CTGAATTGCA
GAAGGGGGTT AGGTATGGGT GCCCACTGGA GGATGTAACT ACAGGATTAC AAATCCAATG CCGTGGATGG AGATCAGTGT
ACTACAACCC CAAAAGAAAG GGATTCTTAG GCATGACACC CACCTCACTA GGCCAGATCC TGGTCCTGTA CAAGAGATGG
ACAGAAGGGT TCCTCCAAAT ATCCCTCTCA CGGTACAGCC CCTTCTTATT AGGTCATGGG AAGATCAAGC TGGGTCTTCA
AATGGGCTAC TCTGTCTGCG GCTTCTGGGC CGTGAACAGC TTCCCCACCT TGTACTATGT CACAATTCCT TCTCTTTGCT
TCCTCAATGG CATCTCCCTC TTTCCTGAGG TAAGTTTCCA TATGCTTTAA CGTTTGTTCA GACATTTGTA CGCACTTGGC
TTAAAGTTTA ACACAAGATT TACATCTGCA ATTAACTCAG AAAACTAGCC CCTGGTTCAT ACCCTTTGCG TACGTTATGG
TGGCCGCATA CTCCTGCAGC TTAGCAGAGT CACTGCAATG TGGTGACAGT GCAGTGGAGT GGTGGAATGC ACAGAGGATG
TGGCTCATTA GAAGGATCAC CTCATACCTC CTGGCAACCA TCGACACATT CCGCAGAATA TTGGGCATCT CTGAGTCTGG
ATTCAACCTG ACAGTGAAGG TCACTGACTT GCAGGCCTTG GAGAGGTACA AGAAGGGGAT GATGGAATTC GGATCCTTCT
CGGCGATGTT TGTAATCCTT ACGACAGTTG CGCTGCTCAA CCTGGCATGC ATGGTGTTAG GAATTAGTAG AGTTTTGTTA
CAAGAAGGCC CAGGGGGTTT GGAAACTTTG TTTCTCCAGG CTGTTCTGTG TGTACTGATA GTAGCCATCA ATTCTCCGGT
TTATGAGGCG CTCTTCCTCC GCAGGGACAA GGGCAGCTTG CCAGCTTCTG TCGCTCGAGT TTCCATTTGC TTTGTGTTGC
CACTCTGTAT ACTCTCAATA TGTAAATGAT ATTACGTACA GTATGTACAA TGCTATATAT CAGGAAGAAA TTAAACTT