Os02t0725300-02

Locus

Os02g0725300

Description

Similar to cDNA clone:J033042D19, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLE2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE E2

Oryzabase Gene Symbol Synonym(s)

OsCslE2, OsCSLE2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK107881 (DDBJ, Best hit)

Protein Evidence

B7ERT8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

002-134-D06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725300-02)

RiceXPro (AK107881)

Others

Oryzabase (13898)

KEGG (Os02t0725300-02)

Transcript

819 bp

>Os02t0725300-02 Similar to cDNA clone:J033042D19, full insert sequence.
CTCTGAAGTCCCAGTGCCATCTGCTCCATACTTCGCAGGTAGGAGGGAGCATGGCGGGGA
GCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTCGCGACGGAGA
AACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTCTTCGCGGGAG
TTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGCGACGGCGTGC
GGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTCTACTGGGTCC
TGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGACCGCCTCGCTC
AAAGCTACAGTGAAGACGAGCTTCCCAGTGTGGACATTTTTGTCTGTACAGCGGATCCAA
CAGCAGAGCCACCGATGCTTGTCATCTCCACTGTTTTGTCTGTCATGGCTTATGACTACC
TGCCTGAGAAGCTGAACATCTACTTATCTGATGATGCTGGTTCGGTTTTAACATTCTACG
TTCTATGCGAGGCATCCGAGTTTGCAAAGCATTGGATTCCATTTTGCAAGAAGTACAAGG
TGGAACCCAGATCACCAGCTGCTTACTTTGCTAAAGTAGCTTCCCCTCCTGATGGGTGTG
GACCTAAAGAGTGGTTTACCATGAAGGTAGAGTTGAAACTGTTGTGATGTAATGTAGTTC
ATCTTCAACTAAATTGCTGTTGTGCACTATTACTTTTTTTTCGCCGGGAAGGCCGAAGGA
GGCCATCCAaatatattaagaaggagtaaaagttacaag

CDS

657 bp

>Os02t0725300-02 Similar to cDNA clone:J033042D19, full insert sequence.
ATGGCGGGGAGCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTC
GCGACGGAGAAACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTC
TTCGCGGGAGTTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGC
GACGGCGTGCGGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTC
TACTGGGTCCTGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGAC
CGCCTCGCTCAAAGCTACAGTGAAGACGAGCTTCCCAGTGTGGACATTTTTGTCTGTACA
GCGGATCCAACAGCAGAGCCACCGATGCTTGTCATCTCCACTGTTTTGTCTGTCATGGCT
TATGACTACCTGCCTGAGAAGCTGAACATCTACTTATCTGATGATGCTGGTTCGGTTTTA
ACATTCTACGTTCTATGCGAGGCATCCGAGTTTGCAAAGCATTGGATTCCATTTTGCAAG
AAGTACAAGGTGGAACCCAGATCACCAGCTGCTTACTTTGCTAAAGTAGCTTCCCCTCCT
GATGGGTGTGGACCTAAAGAGTGGTTTACCATGAAGGTAGAGTTGAAACTGTTGTGA

Protein

219 aa

>Os02t0725300-02 Similar to cDNA clone:J033042D19, full insert sequence.
MAGSGGGVVSGGRQRGPPLFATEKPGRMAMAAYRVSAATVFAGVLLIWLYRATHLPPGGG
DGVRRWAWLGMLAAELWFGFYWVLTLSVRWCPVYRRTFKDRLAQSYSEDELPSVDIFVCT
ADPTAEPPMLVISTVLSVMAYDYLPEKLNIYLSDDAGSVLTFYVLCEASEFAKHWIPFCK
KYKVEPRSPAAYFAKVASPPDGCGPKEWFTMKVELKLL*

5'UTR

chr02:30148866..30148915 (+ strand) : 50 bp

CDS

chr02:30148916..30149229 (+ strand) : 314 bp

chr02:30149444..30149786 (+ strand) : 343 bp

3'UTR

chr02:30149787..30149898 (+ strand) : 112 bp

FASTA

>Os02t0725300-02 class=Sequence position=chr02:30148866..30149898 (+ strand)
CTCTGAAGTC CCAGTGCCAT CTGCTCCATA CTTCGCAGGT AGGAGGGAGC ATGGCGGGGA GCGGCGGCGG CGTCGTCTCC
GGCGGCCGCC AGCGCGGGCC CCCGCTGTTC GCGACGGAGA AACCGGGGCG GATGGCGATG GCGGCGTACC GGGTGTCCGC
GGCCACGGTC TTCGCGGGAG TTCTTCTGAT ATGGCTGTAC AGAGCCACTC ACCTGCCTCC CGGTGGCGGC GACGGCGTGC
GGCGGTGGGC GTGGCTCGGG ATGCTCGCGG CGGAGCTCTG GTTCGGCTTC TACTGGGTCC TGACGCTGTC CGTGCGGTGG
TGCCCCGTCT ACCGCCGCAC CTTCAAAGAC CGCCTCGCTC AAAGGTACCT CCCGGCTCTC GATAGTACCA GCAACTGCTA
TCAAGGTTAA TCTGTGTCGC AATTCCTTCT CCTTGCTTGG TTTGTTCTTT CATTGGATAT GTACTGATTA TCCTTTGCTC
AAAAAAGATA TGTAGTATTG ATTACGTTTG CTCAAAAAGG ATATGTAGAA TTGTTGTTGA AAGACATGCT ATGATGCTAG
AATTTTGATT GCAAACAGCT ACAGTGAAGA CGAGCTTCCC AGTGTGGACA TTTTTGTCTG TACAGCGGAT CCAACAGCAG
AGCCACCGAT GCTTGTCATC TCCACTGTTT TGTCTGTCAT GGCTTATGAC TACCTGCCTG AGAAGCTGAA CATCTACTTA
TCTGATGATG CTGGTTCGGT TTTAACATTC TACGTTCTAT GCGAGGCATC CGAGTTTGCA AAGCATTGGA TTCCATTTTG
CAAGAAGTAC AAGGTGGAAC CCAGATCACC AGCTGCTTAC TTTGCTAAAG TAGCTTCCCC TCCTGATGGG TGTGGACCTA
AAGAGTGGTT TACCATGAAG GTAGAGTTGA AACTGTTGTG ATGTAATGTA GTTCATCTTC AACTAAATTG CTGTTGTGCA
CTATTACTTT TTTTTCGCCG GGAAGGCCGA AGGAGGCCAT CCAaatatat taagaaggag taaaagttac aag