Os02t0725300-03

Locus

Os02g0725300

Description

Similar to cDNA clone:J033042D19, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLE2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE E2

Oryzabase Gene Symbol Synonym(s)

OsCslE2, OsCSLE2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK111344 (DDBJ, Best hit)

Protein Evidence

B7ERT8 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-181-F12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725300-03)

RiceXPro (AK111344)

Others

Oryzabase (13898)

KEGG (Os02t0725300-03)

Transcript

513 bp

>Os02t0725300-03 Similar to cDNA clone:J033042D19, full insert sequence.
CTCTGAAGTCCCAGTGCCATCTGCTCCATACTTCGCAGGTAGGAGGGAGCATGGCGGGGA
GCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTCGCGACGGAGA
AACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTCTTCGCGGGAG
TTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGCGACGGCGTGC
GGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTCTACTGGGTCC
TGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGACCGCCTCGCTC
AAAGGTACCTCCCGGCTCTCGATAGTACCAGCAACTGCTATCAAGGTTAATCTGTGTCGC
AATTCCTTCTCCTTGCTTGGTTTGTTCTTTCATTGGATATGTACTGATTATCCTTTGCTC
AAAAAAGATATGTAGTATTGATTACGTTTGCTC

CDS

360 bp

>Os02t0725300-03 Similar to cDNA clone:J033042D19, full insert sequence.
ATGGCGGGGAGCGGCGGCGGCGTCGTCTCCGGCGGCCGCCAGCGCGGGCCCCCGCTGTTC
GCGACGGAGAAACCGGGGCGGATGGCGATGGCGGCGTACCGGGTGTCCGCGGCCACGGTC
TTCGCGGGAGTTCTTCTGATATGGCTGTACAGAGCCACTCACCTGCCTCCCGGTGGCGGC
GACGGCGTGCGGCGGTGGGCGTGGCTCGGGATGCTCGCGGCGGAGCTCTGGTTCGGCTTC
TACTGGGTCCTGACGCTGTCCGTGCGGTGGTGCCCCGTCTACCGCCGCACCTTCAAAGAC
CGCCTCGCTCAAAGGTACCTCCCGGCTCTCGATAGTACCAGCAACTGCTATCAAGGTTAA

Protein

120 aa

>Os02t0725300-03 Similar to cDNA clone:J033042D19, full insert sequence.
MAGSGGGVVSGGRQRGPPLFATEKPGRMAMAAYRVSAATVFAGVLLIWLYRATHLPPGGG
DGVRRWAWLGMLAAELWFGFYWVLTLSVRWCPVYRRTFKDRLAQRYLPALDSTSNCYQG*

5'UTR

chr02:30148866..30148915 (+ strand) : 50 bp

CDS

chr02:30148916..30149275 (+ strand) : 360 bp

3'UTR

chr02:30149276..30149378 (+ strand) : 103 bp

FASTA

>Os02t0725300-03 class=Sequence position=chr02:30148866..30149378 (+ strand)
CTCTGAAGTC CCAGTGCCAT CTGCTCCATA CTTCGCAGGT AGGAGGGAGC ATGGCGGGGA GCGGCGGCGG CGTCGTCTCC
GGCGGCCGCC AGCGCGGGCC CCCGCTGTTC GCGACGGAGA AACCGGGGCG GATGGCGATG GCGGCGTACC GGGTGTCCGC
GGCCACGGTC TTCGCGGGAG TTCTTCTGAT ATGGCTGTAC AGAGCCACTC ACCTGCCTCC CGGTGGCGGC GACGGCGTGC
GGCGGTGGGC GTGGCTCGGG ATGCTCGCGG CGGAGCTCTG GTTCGGCTTC TACTGGGTCC TGACGCTGTC CGTGCGGTGG
TGCCCCGTCT ACCGCCGCAC CTTCAAAGAC CGCCTCGCTC AAAGGTACCT CCCGGCTCTC GATAGTACCA GCAACTGCTA
TCAAGGTTAA TCTGTGTCGC AATTCCTTCT CCTTGCTTGG TTTGTTCTTT CATTGGATAT GTACTGATTA TCCTTTGCTC
AAAAAAGATA TGTAGTATTG ATTACGTTTG CTC