Os02t0725300-04

Locus

Os02g0725300

Description

Similar to cDNA clone:J033042D19, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLE2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE E2

Oryzabase Gene Symbol Synonym(s)

OsCslE2, OsCSLE2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK120054 (DDBJ, Best hit)

Protein Evidence

B7ERT8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

J013000L05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725300-04)

RiceXPro (AK120054)

Others

Oryzabase (13898)

KEGG (Os02t0725300-04)

Transcript

2507 bp

>Os02t0725300-04 Similar to cDNA clone:J033042D19, full insert sequence.
gctttggcagcctgagtttcccccgcttgacgagctgccgcctcaatccaacatagaaac
tccccacagagaaggggaggagctccaggaagggcgagggtgccgaccggcaacggagaa
gacgacccaccgccgccagctccctttacactgccatctgggcttgcgccgacgccagag
acgcttctgctgctccggctccggcgcaacccaccggcgcccccgtcgcccggccgccgc
accccatctggccgcgccgcatagcccacccggctgaggagggcaccgcggcgtcaccct
ggctgcccggctgccgaggcctgcctgcgccatgggggctcgccgccgcactgccgagcc
gcgcgagcccgggctgcccggaccggccgcgcgccgagctgccgccgccgctcccagccg
ccgccgcctctaggcagccgccatcccagccgtcgagccaccgccaccgcgcccaggctg
ccgcaccgggccagccgcgccgtccctgccgccgctgccgccgcccccccagccacctcg
cgccgccgttgtgccagatccaggcgtggggtggtcggatccggccttggaggcgccgga
tctgctgcctccccacaccgcgccgccatcgccacctccggccgcggtggagggtcttcg
ccggcgtcgtcgtcccgtccacgtcacgccggggggagtcgccgggaggaagaacctcgc
cgccgccttccctgctcgctgccggctttgccgccggcgagctccggcggcggcgaggcg
gtggggagggagtggaggcgtgggcggctagggttttttcgccccctgagccacccgcgc
gagagcgacgCGAGAGGAACTGTACAAAGACATGACAGATCGTGTGAACTCAGTAGTAAA
TTCAGGTAGGATCCCCGAGGTTCCACGATGCCATTCCAGAGGCTTCTCACAGTGGAATGA
GAATTTCACTTCTAGTGATCACCCTTCTATAGTTCAGATTTTAATCGATAGTAACAAACA
AAAGGCAGTTGATATTGATGGAAATGCATTGCCAACACTTGTATATATGGCACGTGAGAA
GAAACCCCAGAAACAGCATCACTTCAAAGCTGGATCTTTGAATGCTTTGATAAGGGTATC
ATCAGTGATAAGCAACAGTCCAATCATCATGAATGTTGATTGTGATATGTACTCAAACAA
TTCAGAGTCCATCAGAGACGCATTGTGTTTTTTCCTAGATGAAGAGCAAGGCCAAGATAT
TGGTTTTGTACAGTATCCTCAGAATTTTGAAAATGTGGTGCACAATGACATCTATGGCCA
CCCAATCAATGTTGTCAACGAGTTGGATCATCCTTGCTTGGATGGTTGGGGTGGAATGTG
TTACTATGGCACTGGATGCTTCCATCGGAGAGAGGCCCTATGTGGACGAATCTATAGTCA
AGAATATAAGGAAGATTGGACTAGGGTAGCAGGGAGAACAGAAGATGCTAATGAGTTGGA
AGAAATGGGCAGGTCACTTGTGACTTGCACATATGAGCATAACACCATCTGGGGAATTGA
GAAGGGGGTTAGGTATGGGTGCCCACTGGAGGATGTAACTACAGGATTACAAATCCAATG
CCGTGGATGGAGATCAGTGTACTACAACCCCAAAAGAAAGGGATTCTTAGGCATGACACC
CACCTCACTAGGCCAGATCCTGGTCCTGTACAAGAGATGGACAGAAGGGTTCCTCCAAAT
ATCCCTCTCACGGTACAGCCCCTTCTTATTAGGTCATGGGAAGATCAAGCTGGGTCTTCA
AATGGGCTACTCTGTCTGCGGCTTCTGGGCCGTGAACAGCTTCCCCACCTTGTACTATGT
CACAATTCCTTCTCTTTGCTTCCTCAATGGCATCTCCCTCTTTCCTGAGAAAACTAGCCC
CTGGTTCATACCCTTTGCGTACGTTATGGTGGCCGCATACTCCTGCAGCTTAGCAGAGTC
ACTGCAATGTGGTGACAGTGCAGTGGAGTGGTGGAATGCACAGAGGATGTGGCTCATTAG
AAGGATCACCTCATACCTCCTGGCAACCATCGACACATTCCGCAGAATATTGGGCATCTC
TGAGTCTGGATTCAACCTGACAGTGAAGGTCACTGACTTGCAGGCCTTGGAGAGGTACAA
GAAGGGGATGATGGAATTCGGATCCTTCTCGGCGATGTTTGTAATCCTTACGACAGTTGC
GCTGCTCAACCTGGCATGCATGGTGTTAGGAATTAGTAGAGTTTTGTTACAAGAAGGCCC
AGGGGGTTTGGAAACTTTGTTTCTCCAGGCTGTTCTGTGTGTACTGATAGTAGCCATCAA
TTCTCCGGTTTATGAGGCGCTCTTCCTCCGCAGGGACAAGGGCAGCTTGCCAGCTTCTGT
CGCTCGAGTTTCCATTTGCTTTGTGTTGCCACTCTGTATACTCTCAATATGTAAATGATA
TTACGTACAGTATGTACAATGCTATATATCAGGAAGAAATTAAACTT

CDS

1629 bp

>Os02t0725300-04 Similar to cDNA clone:J033042D19, full insert sequence.
gccacccgcgcgagagcgacgCGAGAGGAACTGTACAAAGACATGACAGATCGTGTGAAC
TCAGTAGTAAATTCAGGTAGGATCCCCGAGGTTCCACGATGCCATTCCAGAGGCTTCTCA
CAGTGGAATGAGAATTTCACTTCTAGTGATCACCCTTCTATAGTTCAGATTTTAATCGAT
AGTAACAAACAAAAGGCAGTTGATATTGATGGAAATGCATTGCCAACACTTGTATATATG
GCACGTGAGAAGAAACCCCAGAAACAGCATCACTTCAAAGCTGGATCTTTGAATGCTTTG
ATAAGGGTATCATCAGTGATAAGCAACAGTCCAATCATCATGAATGTTGATTGTGATATG
TACTCAAACAATTCAGAGTCCATCAGAGACGCATTGTGTTTTTTCCTAGATGAAGAGCAA
GGCCAAGATATTGGTTTTGTACAGTATCCTCAGAATTTTGAAAATGTGGTGCACAATGAC
ATCTATGGCCACCCAATCAATGTTGTCAACGAGTTGGATCATCCTTGCTTGGATGGTTGG
GGTGGAATGTGTTACTATGGCACTGGATGCTTCCATCGGAGAGAGGCCCTATGTGGACGA
ATCTATAGTCAAGAATATAAGGAAGATTGGACTAGGGTAGCAGGGAGAACAGAAGATGCT
AATGAGTTGGAAGAAATGGGCAGGTCACTTGTGACTTGCACATATGAGCATAACACCATC
TGGGGAATTGAGAAGGGGGTTAGGTATGGGTGCCCACTGGAGGATGTAACTACAGGATTA
CAAATCCAATGCCGTGGATGGAGATCAGTGTACTACAACCCCAAAAGAAAGGGATTCTTA
GGCATGACACCCACCTCACTAGGCCAGATCCTGGTCCTGTACAAGAGATGGACAGAAGGG
TTCCTCCAAATATCCCTCTCACGGTACAGCCCCTTCTTATTAGGTCATGGGAAGATCAAG
CTGGGTCTTCAAATGGGCTACTCTGTCTGCGGCTTCTGGGCCGTGAACAGCTTCCCCACC
TTGTACTATGTCACAATTCCTTCTCTTTGCTTCCTCAATGGCATCTCCCTCTTTCCTGAG
AAAACTAGCCCCTGGTTCATACCCTTTGCGTACGTTATGGTGGCCGCATACTCCTGCAGC
TTAGCAGAGTCACTGCAATGTGGTGACAGTGCAGTGGAGTGGTGGAATGCACAGAGGATG
TGGCTCATTAGAAGGATCACCTCATACCTCCTGGCAACCATCGACACATTCCGCAGAATA
TTGGGCATCTCTGAGTCTGGATTCAACCTGACAGTGAAGGTCACTGACTTGCAGGCCTTG
GAGAGGTACAAGAAGGGGATGATGGAATTCGGATCCTTCTCGGCGATGTTTGTAATCCTT
ACGACAGTTGCGCTGCTCAACCTGGCATGCATGGTGTTAGGAATTAGTAGAGTTTTGTTA
CAAGAAGGCCCAGGGGGTTTGGAAACTTTGTTTCTCCAGGCTGTTCTGTGTGTACTGATA
GTAGCCATCAATTCTCCGGTTTATGAGGCGCTCTTCCTCCGCAGGGACAAGGGCAGCTTG
CCAGCTTCTGTCGCTCGAGTTTCCATTTGCTTTGTGTTGCCACTCTGTATACTCTCAATA
TGTAAATGA

Protein

543 aa

>Os02t0725300-04 Similar to cDNA clone:J033042D19, full insert sequence.
ATRARATREELYKDMTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTSSDHPSIVQILID
SNKQKAVDIDGNALPTLVYMAREKKPQKQHHFKAGSLNALIRVSSVISNSPIIMNVDCDM
YSNNSESIRDALCFFLDEEQGQDIGFVQYPQNFENVVHNDIYGHPINVVNELDHPCLDGW
GGMCYYGTGCFHRREALCGRIYSQEYKEDWTRVAGRTEDANELEEMGRSLVTCTYEHNTI
WGIEKGVRYGCPLEDVTTGLQIQCRGWRSVYYNPKRKGFLGMTPTSLGQILVLYKRWTEG
FLQISLSRYSPFLLGHGKIKLGLQMGYSVCGFWAVNSFPTLYYVTIPSLCFLNGISLFPE
KTSPWFIPFAYVMVAAYSCSLAESLQCGDSAVEWWNAQRMWLIRRITSYLLATIDTFRRI
LGISESGFNLTVKVTDLQALERYKKGMMEFGSFSAMFVILTTVALLNLACMVLGISRVLL
QEGPGGLETLFLQAVLCVLIVAINSPVYEALFLRRDKGSLPASVARVSICFVLPLCILSI
CK*

5'UTR

chr02:30150510..30151338 (+ strand) : 829 bp

CDS

chr02:30151339..30151365 (+ strand) : 27 bp

chr02:30151480..30151620 (+ strand) : 141 bp

chr02:30151859..30151990 (+ strand) : 132 bp

chr02:30152096..30152308 (+ strand) : 213 bp

chr02:30152408..30152626 (+ strand) : 219 bp

chr02:30152779..30153126 (+ strand) : 348 bp

chr02:30153218..30153766 (+ strand) : 549 bp

3'UTR

chr02:30153767..30153815 (+ strand) : 49 bp

FASTA

>Os02t0725300-04 class=Sequence position=chr02:30150510..30153815 (+ strand)
gctttggcag cctgagtttc ccccgcttga cgagctgccg cctcaatcca acatagaaac tccccacaga gaaggggagg
agctccagga agggcgaggg tgccgaccgg caacggagaa gacgacccac cgccgccagc tccctttaca ctgccatctg
ggcttgcgcc gacgccagag acgcttctgc tgctccggct ccggcgcaac ccaccggcgc ccccgtcgcc cggccgccgc
accccatctg gccgcgccgc atagcccacc cggctgagga gggcaccgcg gcgtcaccct ggctgcccgg ctgccgaggc
ctgcctgcgc catgggggct cgccgccgca ctgccgagcc gcgcgagccc gggctgcccg gaccggccgc gcgccgagct
gccgccgccg ctcccagccg ccgccgcctc taggcagccg ccatcccagc cgtcgagcca ccgccaccgc gcccaggctg
ccgcaccggg ccagccgcgc cgtccctgcc gccgctgccg ccgccccccc agccacctcg cgccgccgtt gtgccagatc
caggcgtggg gtggtcggat ccggccttgg aggcgccgga tctgctgcct ccccacaccg cgccgccatc gccacctccg
gccgcggtgg agggtcttcg ccggcgtcgt cgtcccgtcc acgtcacgcc ggggggagtc gccgggagga agaacctcgc
cgccgccttc cctgctcgct gccggctttg ccgccggcga gctccggcgg cggcgaggcg gtggggaggg agtggaggcg
tgggcggcta gggttttttc gccccctgag ccacccgcgc gagagcgacg CGAGAGGTTG TTTTCAGGTT ATCAATTTAG
TCTGTGCACT ATTACTGGCT TCCATTTGGT GCACTACTAG TGATTTACAT GTCTACTTAT TACCTTTACT TTCTTTTTTC
TGTGTTTCAG GAACTGTACA AAGACATGAC AGATCGTGTG AACTCAGTAG TAAATTCAGG TAGGATCCCC GAGGTTCCAC
GATGCCATTC CAGAGGCTTC TCACAGTGGA ATGAGAATTT CACTTCTAGT GATCACCCTT CTATAGTTCA GGTAAAAGTT
ATGTGGTGAT GACCAGGTTA ACAGATGAAG AACATTTAAT TGAATTCAAA ATTCAGAATA ATGAGATGAT TAGAAAATTT
TAAAACAAAG CTGGTGTGTT GGCTCTAATC ATAATTGCTA ACATATAAGA ATGTACATGC ACAAGAAACT TTAATGGGAT
ATGAAATTTG TTTTTCTTGT CTGCAACATA TTTGTGGATT CTGCTGATCA AAGTGTTCTC CATGGCTAGA TTTTAATCGA
TAGTAACAAA CAAAAGGCAG TTGATATTGA TGGAAATGCA TTGCCAACAC TTGTATATAT GGCACGTGAG AAGAAACCCC
AGAAACAGCA TCACTTCAAA GCTGGATCTT TGAATGCTTT GGTGGGTCTT TTAGCCACTC TATGGTCCAT GATTTTCTAC
CGCAACAATT TAGAGTCAAC CTTATCGTGT TTCTAGAATT CCTTAAATTA TGGTCAATAT TTGCAGATAA GGGTATCATC
AGTGATAAGC AACAGTCCAA TCATCATGAA TGTTGATTGT GATATGTACT CAAACAATTC AGAGTCCATC AGAGACGCAT
TGTGTTTTTT CCTAGATGAA GAGCAAGGCC AAGATATTGG TTTTGTACAG TATCCTCAGA ATTTTGAAAA TGTGGTGCAC
AATGACATCT ATGGCCACCC AATCAATGTT GTCAACGAGG TCAGTAGTAA GATAGCATAG CATCTCCTGA AATTTCAGTG
GACATACTTA CACAATTGGA CCTAACTTTG TTTGTGATTT CATTCCGTTG ATCACCAGTT GGATCATCCT TGCTTGGATG
GTTGGGGTGG AATGTGTTAC TATGGCACTG GATGCTTCCA TCGGAGAGAG GCCCTATGTG GACGAATCTA TAGTCAAGAA
TATAAGGAAG ATTGGACTAG GGTAGCAGGG AGAACAGAAG ATGCTAATGA GTTGGAAGAA ATGGGCAGGT CACTTGTGAC
TTGCACATAT GAGCATAACA CCATCTGGGG AATTGAGGTA TGTTAGTCTC TTACTTCATA CCCTGAACAT GTAAACTGTT
GGATTTTATC CTCTATAGCC ATCAACCAGC AATGGGCATT CGCATAGTTA CAGAACTTTG TTCATTTTGT ACTGATTACA
GCTACTGACT TCAAGTTGCT GAATTGCAGA AGGGGGTTAG GTATGGGTGC CCACTGGAGG ATGTAACTAC AGGATTACAA
ATCCAATGCC GTGGATGGAG ATCAGTGTAC TACAACCCCA AAAGAAAGGG ATTCTTAGGC ATGACACCCA CCTCACTAGG
CCAGATCCTG GTCCTGTACA AGAGATGGAC AGAAGGGTTC CTCCAAATAT CCCTCTCACG GTACAGCCCC TTCTTATTAG
GTCATGGGAA GATCAAGCTG GGTCTTCAAA TGGGCTACTC TGTCTGCGGC TTCTGGGCCG TGAACAGCTT CCCCACCTTG
TACTATGTCA CAATTCCTTC TCTTTGCTTC CTCAATGGCA TCTCCCTCTT TCCTGAGGTA AGTTTCCATA TGCTTTAACG
TTTGTTCAGA CATTTGTACG CACTTGGCTT AAAGTTTAAC ACAAGATTTA CATCTGCAAT TAACTCAGAA AACTAGCCCC
TGGTTCATAC CCTTTGCGTA CGTTATGGTG GCCGCATACT CCTGCAGCTT AGCAGAGTCA CTGCAATGTG GTGACAGTGC
AGTGGAGTGG TGGAATGCAC AGAGGATGTG GCTCATTAGA AGGATCACCT CATACCTCCT GGCAACCATC GACACATTCC
GCAGAATATT GGGCATCTCT GAGTCTGGAT TCAACCTGAC AGTGAAGGTC ACTGACTTGC AGGCCTTGGA GAGGTACAAG
AAGGGGATGA TGGAATTCGG ATCCTTCTCG GCGATGTTTG TAATCCTTAC GACAGTTGCG CTGCTCAACC TGGCATGCAT
GGTGTTAGGA ATTAGTAGAG TTTTGTTACA AGAAGGCCCA GGGGGTTTGG AAACTTTGTT TCTCCAGGCT GTTCTGTGTG
TACTGATAGT AGCCATCAAT TCTCCGGTTT ATGAGGCGCT CTTCCTCCGC AGGGACAAGG GCAGCTTGCC AGCTTCTGTC
GCTCGAGTTT CCATTTGCTT TGTGTTGCCA CTCTGTATAC TCTCAATATG TAAATGATAT TACGTACAGT ATGTACAATG
CTATATATCA GGAAGAAATT AAACTT