Os02t0725700-01

Locus

Os02g0725700

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3E

CGSNL Gene Name

HAP3E SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3E, OsLEC1/OsHAP3E, OsLEC1, OsNF-YB7, NF-YB7, NFYB7, L1L

Oryzabase Gene Name Synonym(s)

HAP3 subunit E, LEC1-type 3 subunit protein-E, leafy cotyledon 1, NUCLEAR FACTOR-Y subunit B7, NUCLEAR FACTOR-Y subunit NF-YB7, LEC1-LIKE, LEAFY COTYLEDON1-LIKE, HAP3 SUBUNIT E, NF-YB subunit 7, NF-YB family 7

Transcript Evidence

AK107861 (DDBJ, Best hit)

Protein Evidence

Q84N51 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

002-134-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725700-01)

RiceXPro (AK107861)

Others

Oryzabase (8484)

KEGG (Os02t0725700-01)

Transcript

1078 bp

>Os02t0725700-01 Histone-fold domain containing protein.
AATGGAGGCCGGCTACCCGGGCACGGCGGCGAACGGCGCTGCCGCCGACGGGAACGGTGG
CGCGCAGCAGGCGGCGGCCGCGCCGGCTATACGTGAGCAGGACCGGCTGATGCCGATCGC
GAACGTGATCCGCATCATGCGCCGCGTGCTCCCGGCGCACGCCAAGATCTCGGACGACGC
CAAGGAGACGATCCAGGAGTGCGTGTCGGAGTACATCAGCTTCATCACCGGGGAGGCCAA
CGAGCGGTGCCAGCGCGAGCAGCGCAAGACCATCACCGCCGAGGACGTGCTCTGGGCCAT
GAGCCGCCTCGGCTTCGACGACTACGTCGAGCCCCTCGGCGTCTACCTCCACCGCTACCG
CGAGTTCGAGGGGGAGTCCCGCGGCGTCGGCGTCGGCGTCGGCGCCGCGCGCGGCGACCA
CCACCATGGTCACGTCGGTGGGATGCTCAAGTCCCGCGCGCAGGGCTCCATGGTGACGCA
CCACGACATGCAGATGCACGCCGCCATGTACGGTGGCGGCGCGGTGCCGCCGCCGCCGCA
TCCTCCTCCGCACCACCACGCGTTCCACCAGCTCATGCCGCCGCACCACGGCCAGTACGC
GCCGCCGTACGACATGTACGGCGGCGAGCACGGGATGGCGGCGTACTACGGCGGGATGTA
CGCGCCCGGCAGCGGCGGCGACGGGAGCGGCAGCAGCGGCAGCGGTGGCGCCGGCACGCC
GCAGACCGTCAACTTCGAGCACCAGCATCCGTTCGGATACAAGTAGTAACAGCAGCAGAA
TGGCGATCGGTCTGCACCTGCATGCACACGTATCGCATGCAGATCGAGCTAGTAGTGCAA
CTGGCTAACTTGAACCAGTTAAAAACTTAAGACTTAGTGATCGTGTGTGGTTTAATTAAT
TTGCTACGTTCAGGTAGTGATCGATGAGATTTTAATTTCCTACTGTCAGTTTAATTCACC
GTTCATGTACTCGATCCAGCTAGTACTACTCCTAGTTACCCTTGTTCTAATCTTAACGCA
ATTGTGTCGATCGGACGATCGCACGTTTATCTTCAAGTGGAATTTGTCTTATAACACT

CDS

765 bp

>Os02t0725700-01 Histone-fold domain containing protein.
ATGGAGGCCGGCTACCCGGGCACGGCGGCGAACGGCGCTGCCGCCGACGGGAACGGTGGC
GCGCAGCAGGCGGCGGCCGCGCCGGCTATACGTGAGCAGGACCGGCTGATGCCGATCGCG
AACGTGATCCGCATCATGCGCCGCGTGCTCCCGGCGCACGCCAAGATCTCGGACGACGCC
AAGGAGACGATCCAGGAGTGCGTGTCGGAGTACATCAGCTTCATCACCGGGGAGGCCAAC
GAGCGGTGCCAGCGCGAGCAGCGCAAGACCATCACCGCCGAGGACGTGCTCTGGGCCATG
AGCCGCCTCGGCTTCGACGACTACGTCGAGCCCCTCGGCGTCTACCTCCACCGCTACCGC
GAGTTCGAGGGGGAGTCCCGCGGCGTCGGCGTCGGCGTCGGCGCCGCGCGCGGCGACCAC
CACCATGGTCACGTCGGTGGGATGCTCAAGTCCCGCGCGCAGGGCTCCATGGTGACGCAC
CACGACATGCAGATGCACGCCGCCATGTACGGTGGCGGCGCGGTGCCGCCGCCGCCGCAT
CCTCCTCCGCACCACCACGCGTTCCACCAGCTCATGCCGCCGCACCACGGCCAGTACGCG
CCGCCGTACGACATGTACGGCGGCGAGCACGGGATGGCGGCGTACTACGGCGGGATGTAC
GCGCCCGGCAGCGGCGGCGACGGGAGCGGCAGCAGCGGCAGCGGTGGCGCCGGCACGCCG
CAGACCGTCAACTTCGAGCACCAGCATCCGTTCGGATACAAGTAG

Protein

255 aa

>Os02t0725700-01 Histone-fold domain containing protein.
MEAGYPGTAANGAAADGNGGAQQAAAAPAIREQDRLMPIANVIRIMRRVLPAHAKISDDA
KETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLGVYLHRYR
EFEGESRGVGVGVGAARGDHHHGHVGGMLKSRAQGSMVTHHDMQMHAAMYGGGAVPPPPH
PPPHHHAFHQLMPPHHGQYAPPYDMYGGEHGMAAYYGGMYAPGSGGDGSGSSGSGGAGTP
QTVNFEHQHPFGYK*

5'UTR

chr02:30165377..30165377 (- strand) : 1 bp

CDS

chr02:30164612..30165376 (- strand) : 765 bp

3'UTR

chr02:30164300..30164611 (- strand) : 312 bp

FASTA

>Os02t0725700-01 class=Sequence position=chr02:30164300..30165377 (- strand)
AATGGAGGCC GGCTACCCGG GCACGGCGGC GAACGGCGCT GCCGCCGACG GGAACGGTGG CGCGCAGCAG GCGGCGGCCG
CGCCGGCTAT ACGTGAGCAG GACCGGCTGA TGCCGATCGC GAACGTGATC CGCATCATGC GCCGCGTGCT CCCGGCGCAC
GCCAAGATCT CGGACGACGC CAAGGAGACG ATCCAGGAGT GCGTGTCGGA GTACATCAGC TTCATCACCG GGGAGGCCAA
CGAGCGGTGC CAGCGCGAGC AGCGCAAGAC CATCACCGCC GAGGACGTGC TCTGGGCCAT GAGCCGCCTC GGCTTCGACG
ACTACGTCGA GCCCCTCGGC GTCTACCTCC ACCGCTACCG CGAGTTCGAG GGGGAGTCCC GCGGCGTCGG CGTCGGCGTC
GGCGCCGCGC GCGGCGACCA CCACCATGGT CACGTCGGTG GGATGCTCAA GTCCCGCGCG CAGGGCTCCA TGGTGACGCA
CCACGACATG CAGATGCACG CCGCCATGTA CGGTGGCGGC GCGGTGCCGC CGCCGCCGCA TCCTCCTCCG CACCACCACG
CGTTCCACCA GCTCATGCCG CCGCACCACG GCCAGTACGC GCCGCCGTAC GACATGTACG GCGGCGAGCA CGGGATGGCG
GCGTACTACG GCGGGATGTA CGCGCCCGGC AGCGGCGGCG ACGGGAGCGG CAGCAGCGGC AGCGGTGGCG CCGGCACGCC
GCAGACCGTC AACTTCGAGC ACCAGCATCC GTTCGGATAC AAGTAGTAAC AGCAGCAGAA TGGCGATCGG TCTGCACCTG
CATGCACACG TATCGCATGC AGATCGAGCT AGTAGTGCAA CTGGCTAACT TGAACCAGTT AAAAACTTAA GACTTAGTGA
TCGTGTGTGG TTTAATTAAT TTGCTACGTT CAGGTAGTGA TCGATGAGAT TTTAATTTCC TACTGTCAGT TTAATTCACC
GTTCATGTAC TCGATCCAGC TAGTACTACT CCTAGTTACC CTTGTTCTAA TCTTAACGCA ATTGTGTCGA TCGGACGATC
GCACGTTTAT CTTCAAGTGG AATTTGTCTT ATAACACT