Os02t0725900-01

Locus

Os02g0725900

Description

Component of the NF-Y/HAP transcription factor complex, Regulation of endosperm development

RAP-DB Gene Symbol Synonym(s)

HAP3K, OsHAP3K/OsNF-YB1, OsHAP3K, OsNF-YB1, nf-yb1, OsLEC1, OsNF-YB-1, NFYB1, OsEnS-41

RAP-DB Gene Name Synonym(s)

HAP3K SUBUNIT OF CCAAT-BOX BINDING COMPLEX, Nuclear transcription factor Y subunit B-1, CCAAT-binding transcription factor subunit NF-YB1, leafy cotyledon 1, endosperm-specific gene 41, Nuclear Factor YB1

CGSNL Gene Symbol

HAP3K

CGSNL Gene Name

HAP3K SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3K/OsNF-YB1, OsHAP3K, OsNF-YB1, NF-YB1, nf-yb1, OsLEC1, OsNF-YB-1, NFYB1, OsEnS-41

Oryzabase Gene Name Synonym(s)

Nuclear transcription factor Y subunit B-1, CCAAT-binding transcription factor subunit NF-YB1, leafy cotyledon 1, endosperm-specific gene 41, Nuclear Factor YB1, NUCLEAR FACTOR-Y subunit B1, NUCLEAR FACTOR-Y subunit NF-YB1, NF-YB subunit 1, NF-YB family 1

Transcript Evidence

AJ300218 (Arborio)

AK241920

Protein Evidence

Q6Z348

Q0DXY7

Literature

PMID: 25178525

PMID: 18193457

PMID: 11971906

Note

Manual Curation

July 7, 2015

Gene Ontology (GO)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein heterodimerization activity (GO:0046982)

Cellular Component: intracellular (GO:0005622)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Full-length cDNA

J075074G07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0725900-01)

Others

Oryzabase (8490)

KEGG (Os02t0725900-01)

Transcript

864 bp

>Os02t0725900-01 Component of the NF-Y/HAP transcription factor complex, Regulation of endosperm development
ATCACAATCCAATACAAGTTCACAACATAAGCATAGTACAGGTCATTGAGACTTGAGAGA
GCATGGCAGGGAACAAAAAGCGTGGTGGCAGGAACATGGATCAGGTCAAGAAGGCGGCAG
TGAGATCGGATGGGGTGGGAGGTAGTGCGACCAACGCCGAGCTGCCGATGGCCAACCTCG
TACGCCTGATAAAGAAGGTGCTCCCAGGGAAAGCGAAGATCGGGGGAGCAGCCAAGGGTC
TCACCCATGATTGCGCGGTGGAGTTCGTCGGGTTCGTCGGCGACGAGGCCTCCGAGAAGG
CCAAGGCAGAGCACCGCCGCACCGTAGCGCCGGAAGACTACTTGGGCTCATTCGGCGACC
TTGGCTTCGATCGCTACGTCGACCCCATGGATGCCTACATCCATGGTTACCGTGAGTTTG
AGAGGGCTGGTGGGAATAGGAGGGTGGCGCCGCCTCCTCCGGCGGCAGCTACACCGCTGA
CGCCCGGTGGACCGACATTCACTGACGCAGAGCTGCAGTTTCTCCGGTCGGTGATCCCCT
CCAGAAGTGATGATGAATATAGCGGCTCATCACCAGCCATAGGCGGCTATGGCTATGGAT
ATGGCTATGGAAAAAATATGTGAACAACTTGATGCATGTGTGTGTGTACACTGCATGCAT
GCGTGGAGGGTCAAACAGAGTCAAGACTCTTGTGGTGGTTTCAATAAGTCTCTAGTGACA
ATATAAGTTGTGTATCGTTGTTTCCTTTGTAAAAAAAAACGTCATGTATCGTTGTGTGTC
CTCATCCGGTAATCCTTTACGTGGGTGGGTTATGCGAGAAAAAGAAAATGACGTTGCATC
AAATAAAATGCTTGATGTTTGCGT

CDS

561 bp

>Os02t0725900-01 Component of the NF-Y/HAP transcription factor complex, Regulation of endosperm development
ATGGCAGGGAACAAAAAGCGTGGTGGCAGGAACATGGATCAGGTCAAGAAGGCGGCAGTG
AGATCGGATGGGGTGGGAGGTAGTGCGACCAACGCCGAGCTGCCGATGGCCAACCTCGTA
CGCCTGATAAAGAAGGTGCTCCCAGGGAAAGCGAAGATCGGGGGAGCAGCCAAGGGTCTC
ACCCATGATTGCGCGGTGGAGTTCGTCGGGTTCGTCGGCGACGAGGCCTCCGAGAAGGCC
AAGGCAGAGCACCGCCGCACCGTAGCGCCGGAAGACTACTTGGGCTCATTCGGCGACCTT
GGCTTCGATCGCTACGTCGACCCCATGGATGCCTACATCCATGGTTACCGTGAGTTTGAG
AGGGCTGGTGGGAATAGGAGGGTGGCGCCGCCTCCTCCGGCGGCAGCTACACCGCTGACG
CCCGGTGGACCGACATTCACTGACGCAGAGCTGCAGTTTCTCCGGTCGGTGATCCCCTCC
AGAAGTGATGATGAATATAGCGGCTCATCACCAGCCATAGGCGGCTATGGCTATGGATAT
GGCTATGGAAAAAATATGTGA

Protein

187 aa

>Os02t0725900-01 Component of the NF-Y/HAP transcription factor complex, Regulation of endosperm development
MAGNKKRGGRNMDQVKKAAVRSDGVGGSATNAELPMANLVRLIKKVLPGKAKIGGAAKGL
THDCAVEFVGFVGDEASEKAKAEHRRTVAPEDYLGSFGDLGFDRYVDPMDAYIHGYREFE
RAGGNRRVAPPPPAAATPLTPGGPTFTDAELQFLRSVIPSRSDDEYSGSSPAIGGYGYGY
GYGKNM*

5'UTR

chr02:30192427..30192488 (- strand) : 62 bp

CDS

chr02:30192405..30192426 (- strand) : 22 bp

chr02:30191726..30192264 (- strand) : 539 bp

3'UTR

chr02:30191485..30191725 (- strand) : 241 bp

FASTA

>Os02t0725900-01 class=Sequence position=chr02:30191485..30192488 (- strand)
ATCACAATCC AATACAAGTT CACAACATAA GCATAGTACA GGTCATTGAG ACTTGAGAGA GCATGGCAGG GAACAAAAAG
CGTGGTATAG TAGTATAGTC AGTACTAGGA TTAGTACTTG ATAACTAGCA CAACAAAAAG CTACTATCAT TTTTGCATTC
AAAGTGGTAA TTAAGAATCG GATGATCATT TTGATTGTTC CTCTTCATTT GTTTTGGATG TCAGGTGGCA GGAACATGGA
TCAGGTCAAG AAGGCGGCAG TGAGATCGGA TGGGGTGGGA GGTAGTGCGA CCAACGCCGA GCTGCCGATG GCCAACCTCG
TACGCCTGAT AAAGAAGGTG CTCCCAGGGA AAGCGAAGAT CGGGGGAGCA GCCAAGGGTC TCACCCATGA TTGCGCGGTG
GAGTTCGTCG GGTTCGTCGG CGACGAGGCC TCCGAGAAGG CCAAGGCAGA GCACCGCCGC ACCGTAGCGC CGGAAGACTA
CTTGGGCTCA TTCGGCGACC TTGGCTTCGA TCGCTACGTC GACCCCATGG ATGCCTACAT CCATGGTTAC CGTGAGTTTG
AGAGGGCTGG TGGGAATAGG AGGGTGGCGC CGCCTCCTCC GGCGGCAGCT ACACCGCTGA CGCCCGGTGG ACCGACATTC
ACTGACGCAG AGCTGCAGTT TCTCCGGTCG GTGATCCCCT CCAGAAGTGA TGATGAATAT AGCGGCTCAT CACCAGCCAT
AGGCGGCTAT GGCTATGGAT ATGGCTATGG AAAAAATATG TGAACAACTT GATGCATGTG TGTGTGTACA CTGCATGCAT
GCGTGGAGGG TCAAACAGAG TCAAGACTCT TGTGGTGGTT TCAATAAGTC TCTAGTGACA ATATAAGTTG TGTATCGTTG
TTTCCTTTGT AAAAAAAAAC GTCATGTATC GTTGTGTGTC CTCATCCGGT AATCCTTTAC GTGGGTGGGT TATGCGAGAA
AAAGAAAATG ACGTTGCATC AAATAAAATG CTTGATGTTT GCGT