Os02t0728500-01

Locus

Os02g0728500

Description

Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL3

Oryzabase Gene Name Synonym(s)

SERK-like gene 3

Transcript Evidence

AK073972 (DDBJ, Best hit)

Protein Evidence

NP_001147975.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Full-length cDNA

J033072J21 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0728500-01)

Others

Oryzabase (13026)

Transcript

2636 bp

>Os02t0728500-01 Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1.
AATTGTGAGAAGAGAAGGCTGCATGCTTCTTTTCCTTGGCCTCACCCTTCCTCCATGTTT
GAACACACCACCACAAGCGATTAGCCCTTCCTCTCCTGCTTCCGCCCTTCCATGGCAATG
GAGGTGGCTCTTGCGGTTTACTCACTGGTGTTGCTTGCCTCCTTCTCCTTCCCTTGCAGG
CTTGCAAGTGCCCTCCTCTCTCCCAAGGGTGTAAACTATGAAGTGCAAGCTCTCATGATG
ATCAAGACTTCCCTCAAGGATCCTCACGGTGTGCTCAAGAACTGGGACCAAGACTCCGTG
GATCCTTGCAGCTGGACCATGGTCACTTGCTCACCTGAGAACCTTGTCACTGGCCTGGAG
GCTCCAAGCCAGAATCTTTCTGGCCTGCTCTCCGCAAGCATAGGCAACTTGACCAATCTT
GAGATAGTTCTTCTGCAGAACAACAACATCAATGGTCCAATTCCAGAAGAGATTGGCAGG
CTAACAAAACTCAAAACACTTGATCTCTCCAGTAACCACTTCTCTGGTGGAATCCCAAAC
TCAGTAGGCCACCTCGAAAGCCTCCAGTACTTGAGGCTCAACAACAACACCCTGTCTGGT
GCATACCCTTCATCATCAGCTAATTTATCACAGCTTGTTTTCCTGGACCTTTCGTATAAT
AATCTGAGTGGTCCAGTACCTGGTTCTTTGGCAAGAACGTTCAATATAGTGGGGAATCCG
TTGATCTGTGCTGCGGGTACGGAACATGATTGTTATGGAACTTTACCAATGCCGATGTCC
TACAGCCTGAATAATACACAGGGTACTCTGATGCCAGCAAAATCTAAAAGCCACAAGGTT
GCAATTGCATTTGGTTCTACAATTGGCTGCATCAGCTTCCTTATCCCTGTTATGGGATTG
CTGTTCTGGTGGAGGCATAGGCGAAACCATCAAATTCTTTTTGATGTTGATGGTAAGCAA
AAAGCCAAACTACTATCCATAATGCCTCAATGCTCGTCAAACTTGGGGGCATACTGGCAT
GCGATGGTTGTTTTCATTGTAACGCATTGGCTATTGCAGAGCAACACACAGAGAATGTCA
ACCTAGGAAATGTGAAGAGGTTTCAGTTCAGAGAGCTTCAGGTTGCAACAGAGAACTTCA
GCAATAAGAACATCTTAGGAAAAGGCGGCTTTGGAAACGTTTACCGGGGAAAGCTACCAG
ATGGAACTGTTGTAGCTGTCAAGAGGCTGAAAGATGGTAATGCTGCAGGCGGGCAGGCAC
AGTTTCAGACTGAAGTTGAGATGATCAGCTTGGCGCTTCACCGGAACCTCCTCAGGCTTT
ATGGGTTCTGCATGACTGCTACTGAGAGGCTTCTGGTATATCCATACATGTCAAATGGGA
GTGTCGCATTGCGTCTGAAAGggaagccaccattggactggatcaccagacagaggatag
cactcggtgcagcaagaggcctactgtacctgcacgagcagtgtgaccccaagattattc
atagggacgtaaaggcagccaacatattgcttgatgactactgtgaagccattgttggag
attttgggcttgccaagctcctagatcatcgtgactcacatgtcaccacagctgtcaggg
gtaccgttgggcacattgccccggaatacctctccaccggccagtcatctgagaagaccg
acgtctttggttttggaattctgctgcttgaattgatcactggtcaaactgcacttgaat
ttgggaagtcatcaaatcagaagggagccatgctggactgggtaagttcattaccatttc
caaagagtttggagcatgggaaaattatcgctagaataaggctagcatatctgtctacca
aatcttgtctcttgccttgacattggcttgtgttcaggtgaagaagatgcaccaggagaa
gaagctcgacgtgcttgtcgacaagggcctgagaagcaactacgaccgtgtcgagctgga
ggagatggtgcaggtggcactgctgtgcacccaatatctccctggtcacaggcccaggat
gtcagaggtggtcaggatgctggagggagatggactggcagagcggtgggaagcatccca
gcgcgctgactcacacaagttcaaagtgcctgagttcaccttcggtcgctgctactctga
cctgacggatgactcgtcattgctggtccaggcagtcgagctctctgggccgagatgaca
cGATAACAAATAGTGGAAGGCAAACCATCATTAGTTGTTTGCAGCAGGATCTGTACAGCA
AGAGACACCACTGTACAATGGAAAAATAGCCAAAAAAAAAAATTTAAAGCAAGCAACTGC
ATGCCAATGCAAAATCACAAATCGAAGCAGGTATCAGATCAGCTGTACAAAGATTAAAAG
AAGAGCACTTCCTAGGCATAGGATATTTCTACTTTTACAGATTCTGTAACTATTGGTAGA
ATAAGTTTGCAGAGCAATATTTTTCAAGATGTAACATTTTGTTTATGCTTTTTTCCTCCC
TTGTACCTTTTGCCTTAGCTAGTGTTAGTTAAAAAAGAAACTGTTGTCATTGGATTATAA
AGACTTGGCAATGACATTTTTGTGCATTGATGCAAAGCTTGAAAATGCATCAAATA

CDS

975 bp

>Os02t0728500-01 Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1.
ATGGCAATGGAGGTGGCTCTTGCGGTTTACTCACTGGTGTTGCTTGCCTCCTTCTCCTTC
CCTTGCAGGCTTGCAAGTGCCCTCCTCTCTCCCAAGGGTGTAAACTATGAAGTGCAAGCT
CTCATGATGATCAAGACTTCCCTCAAGGATCCTCACGGTGTGCTCAAGAACTGGGACCAA
GACTCCGTGGATCCTTGCAGCTGGACCATGGTCACTTGCTCACCTGAGAACCTTGTCACT
GGCCTGGAGGCTCCAAGCCAGAATCTTTCTGGCCTGCTCTCCGCAAGCATAGGCAACTTG
ACCAATCTTGAGATAGTTCTTCTGCAGAACAACAACATCAATGGTCCAATTCCAGAAGAG
ATTGGCAGGCTAACAAAACTCAAAACACTTGATCTCTCCAGTAACCACTTCTCTGGTGGA
ATCCCAAACTCAGTAGGCCACCTCGAAAGCCTCCAGTACTTGAGGCTCAACAACAACACC
CTGTCTGGTGCATACCCTTCATCATCAGCTAATTTATCACAGCTTGTTTTCCTGGACCTT
TCGTATAATAATCTGAGTGGTCCAGTACCTGGTTCTTTGGCAAGAACGTTCAATATAGTG
GGGAATCCGTTGATCTGTGCTGCGGGTACGGAACATGATTGTTATGGAACTTTACCAATG
CCGATGTCCTACAGCCTGAATAATACACAGGGTACTCTGATGCCAGCAAAATCTAAAAGC
CACAAGGTTGCAATTGCATTTGGTTCTACAATTGGCTGCATCAGCTTCCTTATCCCTGTT
ATGGGATTGCTGTTCTGGTGGAGGCATAGGCGAAACCATCAAATTCTTTTTGATGTTGAT
GGTAAGCAAAAAGCCAAACTACTATCCATAATGCCTCAATGCTCGTCAAACTTGGGGGCA
TACTGGCATGCGATGGTTGTTTTCATTGTAACGCATTGGCTATTGCAGAGCAACACACAG
AGAATGTCAACCTAG

Protein

325 aa

>Os02t0728500-01 Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1.
MAMEVALAVYSLVLLASFSFPCRLASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQ
DSVDPCSWTMVTCSPENLVTGLEAPSQNLSGLLSASIGNLTNLEIVLLQNNNINGPIPEE
IGRLTKLKTLDLSSNHFSGGIPNSVGHLESLQYLRLNNNTLSGAYPSSSANLSQLVFLDL
SYNNLSGPVPGSLARTFNIVGNPLICAAGTEHDCYGTLPMPMSYSLNNTQGTLMPAKSKS
HKVAIAFGSTIGCISFLIPVMGLLFWWRHRRNHQILFDVDGKQKAKLLSIMPQCSSNLGA
YWHAMVVFIVTHWLLQSNTQRMST*

5'UTR

chr02:30319695..30319805 (- strand) : 111 bp

CDS

chr02:30319583..30319694 (- strand) : 112 bp

chr02:30319274..30319406 (- strand) : 133 bp

chr02:30319091..30319162 (- strand) : 72 bp

chr02:30318844..30318987 (- strand) : 144 bp

chr02:30318647..30318718 (- strand) : 72 bp

chr02:30318493..30318552 (- strand) : 60 bp

chr02:30318288..30318385 (- strand) : 98 bp

chr02:30317924..30318207 (- strand) : 284 bp

3'UTR

chr02:30317609..30317923 (- strand) : 315 bp

chr02:30316143..30317377 (- strand) : 1235 bp

FASTA

>Os02t0728500-01 class=Sequence position=chr02:30316143..30319805 (- strand)
AATTGTGAGA AGAGAAGGCT GCATGCTTCT TTTCCTTGGC CTCACCCTTC CTCCATGTTT GAACACACCA CCACAAGCGA
TTAGCCCTTC CTCTCCTGCT TCCGCCCTTC CATGGCAATG GAGGTGGCTC TTGCGGTTTA CTCACTGGTG TTGCTTGCCT
CCTTCTCCTT CCCTTGCAGG CTTGCAAGTG CCCTCCTCTC TCCCAAGGGT GTAAACTATG AAGGTTAATA TTCCTTCCTC
AAATCAAGAA CTCTTTTTTT GGTTTTCGTT TGTTTTTTGG CTGCATTGGT GCTTGCTACC TTGTTTTGTA CTCCCATATG
AAGAACTCTC CCGTGGTTCT TCTTTAGTTG TTTCTCTAGC ACTGATTTGT GCTTGTGCGT GTCATAATCT CATCTCCAGT
GCAAGCTCTC ATGATGATCA AGACTTCCCT CAAGGATCCT CACGGTGTGC TCAAGAACTG GGACCAAGAC TCCGTGGATC
CTTGCAGCTG GACCATGGTC ACTTGCTCAC CTGAGAACCT TGTCACTGGC CTGTAAGCAA GCCATCTAGA GTATCATATT
TTTACTCAAC CCCAACATAT CTTGACAAGT TTCCTTTGAC TTGCTGACCT ACCATTATTT GTTTGCTTGT CTGAATTTGA
TAGGGAGGCT CCAAGCCAGA ATCTTTCTGG CCTGCTCTCC GCAAGCATAG GCAACTTGAC CAATCTTGAG ATAGTGTAAG
TTTTACCTGT CGTGATTAGC CTTTGCGATC ATCGCTGTAG ATTCTGCTTC CATTATGTTT CTTGAGTGGG AAGAGATCCT
AATATGTCTT GTTTGTAGTC TTCTGCAGAA CAACAACATC AATGGTCCAA TTCCAGAAGA GATTGGCAGG CTAACAAAAC
TCAAAACACT TGATCTCTCC AGTAACCACT TCTCTGGTGG AATCCCAAAC TCAGTAGGCC ACCTCGAAAG CCTCCAGTAC
TTGTAAGTGC AGTGCAGTTC TGTTCTGTTC TGGTAGCCTT GAATGAGATT CCCCATTTGT AACTTGTCCT CTCAGAAGTC
ACAATTGGTG TAACTCTTCT TATTCTTTTC CATTTTGCTG CTACCAGGAG GCTCAACAAC AACACCCTGT CTGGTGCATA
CCCTTCATCA TCAGCTAATT TATCACAGCT TGTTTTCCTG TGAGTATCCT TTGCTTGTTT TTCTGTTTGG TGATATCTGT
CCTATGTTGT ATGTGCGCTG TGCCGGTTCT TATTGTGGAC TTGCATTTTT CAGGGACCTT TCGTATAATA ATCTGAGTGG
TCCAGTACCT GGTTCTTTGG CAAGAACGTT CAAGTAAGTA TGCAGTCTAA CACCTCAAAA AACAGCTACA GGTTAAATTT
GTTGTAAACT ACCTCCAAGG AAAACAAAAT TTGCCTCAAA ATTTTGCTTA TCTGTTGCAG TATAGTGGGG AATCCGTTGA
TCTGTGCTGC GGGTACGGAA CATGATTGTT ATGGAACTTT ACCAATGCCG ATGTCCTACA GCCTGAATAA TACACAGGGT
ATGCATAAAT CACCTTGCAA ATTGAAATTT GCATTGGCCA TGTAGATAGC AATTGCTCTA ATGGCCTTCT ATCAATAGGT
ACTCTGATGC CAGCAAAATC TAAAAGCCAC AAGGTTGCAA TTGCATTTGG TTCTACAATT GGCTGCATCA GCTTCCTTAT
CCCTGTTATG GGATTGCTGT TCTGGTGGAG GCATAGGCGA AACCATCAAA TTCTTTTTGA TGTTGATGGT AAGCAAAAAG
CCAAACTACT ATCCATAATG CCTCAATGCT CGTCAAACTT GGGGGCATAC TGGCATGCGA TGGTTGTTTT CATTGTAACG
CATTGGCTAT TGCAGAGCAA CACACAGAGA ATGTCAACCT AGGAAATGTG AAGAGGTTTC AGTTCAGAGA GCTTCAGGTT
GCAACAGAGA ACTTCAGCAA TAAGAACATC TTAGGAAAAG GCGGCTTTGG AAACGTTTAC CGGGGAAAGC TACCAGATGG
AACTGTTGTA GCTGTCAAGA GGCTGAAAGA TGGTAATGCT GCAGGCGGGC AGGCACAGTT TCAGACTGAA GTTGAGATGA
TCAGCTTGGC GCTTCACCGG AACCTCCTCA GGCTTTATGG GTTCTGCATG ACTGCTACTG AGAGGCTTCT GGTATATCCA
TACATGTCAA ATGGGAGTGT CGCATTGCGT CTGAAAGGTA AGAACATCAT GATTTCAAGA TGGTTCATGA ATTCCAAAAT
TATAAATCAA ACAGTAATTC CATCATAAAA TAGCTAAATG AAATAGTAAT GAATTGTTCC TCAGTTCTTG ACAAGAGAGC
TTCTTATTTA ATCCTTTCAT TTCTATATCG TTTTCATTGG CCAAAACTTT TTTAAAAAAG AATATGATTC CCATATAACC
AATTTTGTTC TCACGTGACt aattataggg aagccaccat tggactggat caccagacag aggatagcac tcggtgcagc
aagaggccta ctgtacctgc acgagcagtg tgaccccaag attattcata gggacgtaaa ggcagccaac atattgcttg
atgactactg tgaagccatt gttggagatt ttgggcttgc caagctccta gatcatcgtg actcacatgt caccacagct
gtcaggggta ccgttgggca cattgccccg gaatacctct ccaccggcca gtcatctgag aagaccgacg tctttggttt
tggaattctg ctgcttgaat tgatcactgg tcaaactgca cttgaatttg ggaagtcatc aaatcagaag ggagccatgc
tggactgggt aagttcatta ccatttccaa agagtttgga gcatgggaaa attatcgcta gaataaggct agcatatctg
tctaccaaat cttgtctctt gccttgacat tggcttgtgt tcaggtgaag aagatgcacc aggagaagaa gctcgacgtg
cttgtcgaca agggcctgag aagcaactac gaccgtgtcg agctggagga gatggtgcag gtggcactgc tgtgcaccca
atatctccct ggtcacaggc ccaggatgtc agaggtggtc aggatgctgg agggagatgg actggcagag cggtgggaag
catcccagcg cgctgactca cacaagttca aagtgcctga gttcaccttc ggtcgctgct actctgacct gacggatgac
tcgtcattgc tggtccaggc agtcgagctc tctgggccga gatgacacGA TAACAAATAG TGGAAGGCAA ACCATCATTA
GTTGTTTGCA GCAGGATCTG TACAGCAAGA GACACCACTG TACAATGGAA AAATAGCCAA AAAAAAAAAT TTAAAGCAAG
CAACTGCATG CCAATGCAAA ATCACAAATC GAAGCAGGTA TCAGATCAGC TGTACAAAGA TTAAAAGAAG AGCACTTCCT
AGGCATAGGA TATTTCTACT TTTACAGATT CTGTAACTAT TGGTAGAATA AGTTTGCAGA GCAATATTTT TCAAGATGTA
ACATTTTGTT TATGCTTTTT TCCTCCCTTG TACCTTTTGC CTTAGCTAGT GTTAGTTAAA AAAGAAACTG TTGTCATTGG
ATTATAAAGA CTTGGCAATG ACATTTTTGT GCATTGATGC AAAGCTTGAA AATGCATCAA ATA

Locus: Os02g0728500

Loading...

Locus: Os02g0728500

Loading...