Os02t0731700-01

Locus

Os02g0731700

Description

CCT domain domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX8, OsK, OsCCT09, OsGhd2, OsK/Ghd2, BBX8, CCT09, Ghd2

Oryzabase Gene Name Synonym(s)

B-box-containing protein 8, CCT domain-containing gene 9, CCT (CO, CO-LIKE and TOC1) domain protein 9, CCT domain protein 9, "Grain number, plant height, and heading date2", CONSTANS-like 1 protein

Transcript Evidence

AK072346 (DDBJ, Best hit)

Protein Evidence

Q6Z2L0 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

CCT domain (IPR010402)

Full-length cDNA

J023048G07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0731700-01)

Others

Oryzabase (11639)

Transcript

1469 bp

>Os02t0731700-01 CCT domain domain containing protein.
GAGTGCAAGTGAGCTGCATAGATTTTTAGAGGTTTTTTGTGGAATCATCTTTTGTGCTGG
GAGATTTCTTCTGTTTGTTCTTTTGTTTCGTCGTGCCGGAGATGGCGGTGGAGTCGTCGG
ACGAACGGAAGGCCGACGAAGACGGAGCTCACGAGGAGCTCGAGGGGCAGTTGCTGTACC
GCGTTCCGGTCTTTGACCCCTCCCTCGCCGAGTTCTGCTCGCCGCCCCCGATCGATGACG
CGGCGGCCGCATCCTCATCGTGCTTCAAGGAGGACGCCGCCGACGGCGCCGTGGAAGACG
CAAAGTATCCGGCAGCTGCGGCGTCGTCGCCCGTGCAGCAGCTCCCGGATAGCTTTGTCA
ACTTCGAACCGACGGACGCCGAGCTGAGGGAGTTCGCCGCCGACATGGAAGCCCTACTCG
GACAAGGCCTGGACGACAGCAACGAGCTGCAGGACTCGTTCTACATGGAGACCCTAGGGC
TAATAACGCCGCCGGTAGAAGAATCCGGCCGGGTGAAGATGGAGCTCGACGGCGGTGTTG
CCTCCAACAGCAGGGTATCTCTCCCATCATGCCGCGCTCATCCGAAGCCGGAGGACGTCG
AATCCGCCGACGTGCTGGACATCGATTTCAACTGCACCTCGCCGGACGAACAGAAGTCGT
CGGCGAGCAACGGCGCCGCAGCCGATTCGCAGTTCTTCCACAGGAGCCTGGATCTCAGGC
TCAACTACGAGGCGATCATCGAGAGCTGGGGCAACTCGCCGTGGACCGACGGCCGGCCGC
CGCACGGCCAGCTCGACGACTTCTGGCCCAACGACCACCATTACTCGGGGTTGTGGGCTG
CGGGAGGGGGCGGGCATGGCGCGGAGGTGGGGATGATGACGGTGAGGCCGCGGATGGACG
GCCCGGGGCGGGAGGCGCGGGTGACGAGGTACAGGGAGAAGCGGCGTACGCGGCTGTTCT
CCAAGAAGATACGGTACGAGGTGCGGAAGCTGAACGCCGAGAAACGGCCGCGGATGAAGG
GCCGGTTCGTCAAGCGCCCCTCCGCCGCCGCCGCCCCGTGCGCCGTCACCTAGACGTACG
ATCGCGCACGGCCCGGCGCGCGGCACCATGCGTACGTGTCCGGTGTCGAGACTTGCCTGC
GTTCGATCGTATGCCTCATGGACTCGATTGGCACAAAAGTTCACGCAAAATTTGTCGAAG
CTGCACGATTCAAGTAGTATAACGTTGTTCAATTCAAAAGTTTTTCTCTTCCTTTTTTTT
TTCGGTTTTGTTGGTGTTTGGCTCGGTGCTTTTGGATCTCTTTTATCTCTGTTCCATCGA
CCGGAGAGAAAGTAGGCGATTGTACTTGTGTAAACATTGGTGTTCATGGTTTTGTAGAAA
CACTCCATAAAGGAAACAAAATGACTTGTATATGTAAACTGGGTTGTGCCTGCGCCACAC
CCATGTACATTGAGTAATCAGTACATACT

CDS

1044 bp

>Os02t0731700-01 CCT domain domain containing protein.
AGGTTTTTTGTGGAATCATCTTTTGTGCTGGGAGATTTCTTCTGTTTGTTCTTTTGTTTC
GTCGTGCCGGAGATGGCGGTGGAGTCGTCGGACGAACGGAAGGCCGACGAAGACGGAGCT
CACGAGGAGCTCGAGGGGCAGTTGCTGTACCGCGTTCCGGTCTTTGACCCCTCCCTCGCC
GAGTTCTGCTCGCCGCCCCCGATCGATGACGCGGCGGCCGCATCCTCATCGTGCTTCAAG
GAGGACGCCGCCGACGGCGCCGTGGAAGACGCAAAGTATCCGGCAGCTGCGGCGTCGTCG
CCCGTGCAGCAGCTCCCGGATAGCTTTGTCAACTTCGAACCGACGGACGCCGAGCTGAGG
GAGTTCGCCGCCGACATGGAAGCCCTACTCGGACAAGGCCTGGACGACAGCAACGAGCTG
CAGGACTCGTTCTACATGGAGACCCTAGGGCTAATAACGCCGCCGGTAGAAGAATCCGGC
CGGGTGAAGATGGAGCTCGACGGCGGTGTTGCCTCCAACAGCAGGGTATCTCTCCCATCA
TGCCGCGCTCATCCGAAGCCGGAGGACGTCGAATCCGCCGACGTGCTGGACATCGATTTC
AACTGCACCTCGCCGGACGAACAGAAGTCGTCGGCGAGCAACGGCGCCGCAGCCGATTCG
CAGTTCTTCCACAGGAGCCTGGATCTCAGGCTCAACTACGAGGCGATCATCGAGAGCTGG
GGCAACTCGCCGTGGACCGACGGCCGGCCGCCGCACGGCCAGCTCGACGACTTCTGGCCC
AACGACCACCATTACTCGGGGTTGTGGGCTGCGGGAGGGGGCGGGCATGGCGCGGAGGTG
GGGATGATGACGGTGAGGCCGCGGATGGACGGCCCGGGGCGGGAGGCGCGGGTGACGAGG
TACAGGGAGAAGCGGCGTACGCGGCTGTTCTCCAAGAAGATACGGTACGAGGTGCGGAAG
CTGAACGCCGAGAAACGGCCGCGGATGAAGGGCCGGTTCGTCAAGCGCCCCTCCGCCGCC
GCCGCCCCGTGCGCCGTCACCTAG

Protein

348 aa

>Os02t0731700-01 CCT domain domain containing protein.
RFFVESSFVLGDFFCLFFCFVVPEMAVESSDERKADEDGAHEELEGQLLYRVPVFDPSLA
EFCSPPPIDDAAAASSSCFKEDAADGAVEDAKYPAAAASSPVQQLPDSFVNFEPTDAELR
EFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESGRVKMELDGGVASNSRVSLPS
CRAHPKPEDVESADVLDIDFNCTSPDEQKSSASNGAAADSQFFHRSLDLRLNYEAIIESW
GNSPWTDGRPPHGQLDDFWPNDHHYSGLWAAGGGGHGAEVGMMTVRPRMDGPGREARVTR
YREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAPCAVT*

5'UTR

chr02:30475772..30475800 (- strand) : 29 bp

CDS

chr02:30475706..30475771 (- strand) : 66 bp

chr02:30474589..30475320 (- strand) : 732 bp

chr02:30474249..30474494 (- strand) : 246 bp

3'UTR

chr02:30473853..30474248 (- strand) : 396 bp

FASTA

>Os02t0731700-01 class=Sequence position=chr02:30473853..30475800 (- strand)
GAGTGCAAGT GAGCTGCATA GATTTTTAGA GGTTTTTTGT GGAATCATCT TTTGTGCTGG GAGATTTCTT CTGTTTGTTC
TTTTGTTTCG TCGTGACGCA TGAGCTGCAG CTCGGAGAAG GCGGCCGGGG CCGTGGGCGG CAAGGCGGCG CGCGCGTGCG
ACAGCTGCCT GCGGCGGCGG GCGCGGTGGT ACTGCGCGGC GGATGACGCC TTCCTGTGCC AGGGGTGCGA CACGTCGGTG
CACTCGGCCA ACCCGCTCGC CAGGCGGCAC GAGCGCCTGC GCCTGCGCGT CTCGTCGCCC CCGCCGCTGA CGGCGCGGGC
GTCGGTGGAG GAGGAGGCGG CGGCGGCGGT GGGGACGACG ACGACGACGA CGTCGAAGAG AGAGGGCGGC GTCACGCCGG
CATGGTCGAA GCGCAAGGCG CGCACCCGGC GCCCGCAGGT CAAGAGCGTC GGGCAGCTGC TCTCGAGGCG GCTCGTCGTG
CCGGAGATGG CGGTGGAGTC GTCGGACGAA CGGAAGGCCG ACGAAGACGG AGCTCACGAG GAGCTCGAGG GGCAGTTGCT
GTACCGCGTT CCGGTCTTTG ACCCCTCCCT CGCCGAGTTC TGCTCGCCGC CCCCGATCGA TGACGCGGCG GCCGCATCCT
CATCGTGCTT CAAGGAGGAC GCCGCCGACG GCGCCGTGGA AGACGCAAAG TATCCGGCAG CTGCGGCGTC GTCGCCCGTG
CAGCAGCTCC CGGATAGCTT TGTCAACTTC GAACCGACGG ACGCCGAGCT GAGGGAGTTC GCCGCCGACA TGGAAGCCCT
ACTCGGACAA GGCCTGGACG ACAGCAACGA GCTGCAGGAC TCGTTCTACA TGGAGACCCT AGGGCTAATA ACGCCGCCGG
TAGAAGAATC CGGCCGGGTG AAGATGGAGC TCGACGGCGG TGTTGCCTCC AACAGCAGGG TATCTCTCCC ATCATGCCGC
GCTCATCCGA AGCCGGAGGA CGTCGAATCC GCCGACGTGC TGGACATCGA TTTCAACTGC ACCTCGCCGG ACGAACAGAA
GTCGTCGGCG AGCAACGGCG CCGCAGCCGA TTCGCAGTTC TTCCACAGGA GCCTGGATCT CAGGCTCAAC TACGAGGCGA
TCATCGAGAG CTGGGGCAAC TCGCCGTGGA CCGACGGCCG GCCGCCGCAC GGCCAGCTCG ACGACTTCTG GCCCAACGAC
CACCATTACT CGGTACGTGA TTTTTGCAAT TTCAATACCG TGTCGTCCAT ACTCTCATGC TAGCGCATGC GACATGCATA
CTGAATCGAA AACTGTGTTG GTGCAGGGGT TGTGGGCTGC GGGAGGGGGC GGGCATGGCG CGGAGGTGGG GATGATGACG
GTGAGGCCGC GGATGGACGG CCCGGGGCGG GAGGCGCGGG TGACGAGGTA CAGGGAGAAG CGGCGTACGC GGCTGTTCTC
CAAGAAGATA CGGTACGAGG TGCGGAAGCT GAACGCCGAG AAACGGCCGC GGATGAAGGG CCGGTTCGTC AAGCGCCCCT
CCGCCGCCGC CGCCCCGTGC GCCGTCACCT AGACGTACGA TCGCGCACGG CCCGGCGCGC GGCACCATGC GTACGTGTCC
GGTGTCGAGA CTTGCCTGCG TTCGATCGTA TGCCTCATGG ACTCGATTGG CACAAAAGTT CACGCAAAAT TTGTCGAAGC
TGCACGATTC AAGTAGTATA ACGTTGTTCA ATTCAAAAGT TTTTCTCTTC CTTTTTTTTT TCGGTTTTGT TGGTGTTTGG
CTCGGTGCTT TTGGATCTCT TTTATCTCTG TTCCATCGAC CGGAGAGAAA GTAGGCGATT GTACTTGTGT AAACATTGGT
GTTCATGGTT TTGTAGAAAC ACTCCATAAA GGAAACAAAA TGACTTGTAT ATGTAAACTG GGTTGTGCCT GCGCCACACC
CATGTACATT GAGTAATCAG TACATACT

Locus: Os02g0731700

Loading...

Locus: Os02g0731700

Loading...