Os02t0731700-02

Locus

Os02g0731700

Description

Similar to CONSTANS-like 1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX8, OsK, OsCCT09, OsGhd2, OsK/Ghd2, BBX8, CCT09, Ghd2

Oryzabase Gene Name Synonym(s)

B-box-containing protein 8, CCT domain-containing gene 9, CCT (CO, CO-LIKE and TOC1) domain protein 9, CCT domain protein 9, "Grain number, plant height, and heading date2", CONSTANS-like 1 protein

Transcript Evidence

AK120314 (DDBJ, Best hit)

Protein Evidence

Q6Z2L0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, B-box (IPR000315)

CCT domain (IPR010402)

Full-length cDNA

J013055L13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0731700-02)

RiceXPro (AK120314)

Others

Oryzabase (11639)

KEGG (Os02t0731700-02)

Transcript

1941 bp

>Os02t0731700-02 Similar to CONSTANS-like 1 protein.
AGAGGTTTTTTGTGGAATCATCTTTTGTGCTGGGAGATTTCTTCTGTTTGTTCTTTTGTT
TCGTCGTGACGCATGAGCTGCAGCTCGGAGAAGGCGGCCGGGGCCGTGGGCGGCAAGGCG
GCGCGCGCGTGCGACAGCTGCCTGCGGCGGCGGGCGCGGTGGTACTGCGCGGCGGATGAC
GCCTTCCTGTGCCAGGGGTGCGACACGTCGGTGCACTCGGCCAACCCGCTCGCCAGGCGG
CACGAGCGCCTGCGCCTGCGCGTCTCGTCGCCCCCGCCGCTGACGGCGCGGGCGTCGGTG
GAGGAGGAGGCGGCGGCGGCGGTGGGGACGACGACGACGACGACGTCGAAGAGAGAGGGC
GGCGTCACGCCGGCATGGTCGAAGCGCAAGGCGCGCACCCGGCGCCCGCAGGTCAAGAGC
GTCGGGCAGCTGCTCTCGAGGCGGCTCGTCGTGCCGGAGATGGCGGTGGAGTCGTCGGAC
GAACGGAAGGCCGACGAAGACGGAGCTCACGAGGAGCTCGAGGGGCAGTTGCTGTACCGC
GTTCCGGTCTTTGACCCCTCCCTCGCCGAGTTCTGCTCGCCGCCCCCGATCGATGACGCG
GCGGCCGCATCCTCATCGTGCTTCAAGGAGGACGCCGCCGACGGCGCCGTGGAAGACGCA
AAGTATCCGGCAGCTGCGGCGTCGTCGCCCGTGCAGCAGCTCCCGGATAGCTTTGTCAAC
TTCGAACCGACGGACGCCGAGCTGAGGGAGTTCGCCGCCGACATGGAAGCCCTACTCGGA
CAAGGCCTGGACGACAGCAACGAGCTGCAGGACTCGTTCTACATGGAGACCCTAGGGCTA
ATAACGCCGCCGGTAGAAGAATCCGGCCGGGTGAAGATGGAGCTCGACGGCGGTGTTGCC
TCCAACAGCAGGGTATCTCTCCCATCATGCCGCGCTCATCCGAAGCCGGAGGACGTCGAA
TCCGCCGACGTGCTGGACATCGATTTCAACTGCACCTCGCCGGACGAACAGAAGTCGTCG
GCGAGCAACGGCGCCGCAGCCGATTCGCAGTTCTTCCACAGGAGCCTGGATCTCAGGCTC
AACTACGAGGCGATCATCGAGAGCTGGGGCAACTCGCCGTGGACCGACGGCCGGCCGCCG
CACGGCCAGCTCGACGACTTCTGGCCCAACGACCACCATTACTCGGGGTTGTGGGCTGCG
GGAGGGGGCGGGCATGGCGCGGAGGTGGGGATGATGACGGTGAGGCCGCGGATGGACGGC
CCGGGGCGGGAGGCGCGGGTGACGAGGTACAGGGAGAAGCGGCGTACGCGGCTGTTCTCC
AAGAAGATACGGTACGAGGTGCGGAAGCTGAACGCCGAGAAACGGCCGCGGATGAAGGGC
CGGTTCGTCAAGCGCCCCTCCGCCGCCGCCGCCCCGTGCGCCGTCACCTAGACGTACGAT
CGCGCACGGCCCGGCGCGCGGCACCATGCGTACGTGTCCGGTGTCGAGACTTGCCTGCGT
TCGATCGTATGCCTCATGGACTCGATTGGCACAAAAGTTCACGCAAAATTTGTCGAAGCT
GCACGATTCAAGTAGTATAACGTTGTTCAATTCAAAAGTTTTTCTCTTCCTTTTTTTTTT
CGGTTTTGTTGGTGTTTGGCTCGGTGCTTTTGGATCTCTTTTATCTCTGTTCCATCGACC
GGAGAGAAAGTAGGCGATTGTACTTGTGTAAACATTGGTGTTCATGGTTTTGTAGAAACA
CTCCATAAAGGAAACAAAATGACTTGTATATGTAAACTGGGTTGTGCCTGCGCCACACCC
ATGTACATTGAGTAATCAGTACATACTTAATTATTTTCTTGCATGTAGATAACTGGACAA
GTATCTGAAAACTTACCGGGACGATCAAAAGTGTTCATGATAATCACATTCATAAAATCA
CTGCTGTAAGCATTGTCCGCT

CDS

1359 bp

>Os02t0731700-02 Similar to CONSTANS-like 1 protein.
ATGAGCTGCAGCTCGGAGAAGGCGGCCGGGGCCGTGGGCGGCAAGGCGGCGCGCGCGTGC
GACAGCTGCCTGCGGCGGCGGGCGCGGTGGTACTGCGCGGCGGATGACGCCTTCCTGTGC
CAGGGGTGCGACACGTCGGTGCACTCGGCCAACCCGCTCGCCAGGCGGCACGAGCGCCTG
CGCCTGCGCGTCTCGTCGCCCCCGCCGCTGACGGCGCGGGCGTCGGTGGAGGAGGAGGCG
GCGGCGGCGGTGGGGACGACGACGACGACGACGTCGAAGAGAGAGGGCGGCGTCACGCCG
GCATGGTCGAAGCGCAAGGCGCGCACCCGGCGCCCGCAGGTCAAGAGCGTCGGGCAGCTG
CTCTCGAGGCGGCTCGTCGTGCCGGAGATGGCGGTGGAGTCGTCGGACGAACGGAAGGCC
GACGAAGACGGAGCTCACGAGGAGCTCGAGGGGCAGTTGCTGTACCGCGTTCCGGTCTTT
GACCCCTCCCTCGCCGAGTTCTGCTCGCCGCCCCCGATCGATGACGCGGCGGCCGCATCC
TCATCGTGCTTCAAGGAGGACGCCGCCGACGGCGCCGTGGAAGACGCAAAGTATCCGGCA
GCTGCGGCGTCGTCGCCCGTGCAGCAGCTCCCGGATAGCTTTGTCAACTTCGAACCGACG
GACGCCGAGCTGAGGGAGTTCGCCGCCGACATGGAAGCCCTACTCGGACAAGGCCTGGAC
GACAGCAACGAGCTGCAGGACTCGTTCTACATGGAGACCCTAGGGCTAATAACGCCGCCG
GTAGAAGAATCCGGCCGGGTGAAGATGGAGCTCGACGGCGGTGTTGCCTCCAACAGCAGG
GTATCTCTCCCATCATGCCGCGCTCATCCGAAGCCGGAGGACGTCGAATCCGCCGACGTG
CTGGACATCGATTTCAACTGCACCTCGCCGGACGAACAGAAGTCGTCGGCGAGCAACGGC
GCCGCAGCCGATTCGCAGTTCTTCCACAGGAGCCTGGATCTCAGGCTCAACTACGAGGCG
ATCATCGAGAGCTGGGGCAACTCGCCGTGGACCGACGGCCGGCCGCCGCACGGCCAGCTC
GACGACTTCTGGCCCAACGACCACCATTACTCGGGGTTGTGGGCTGCGGGAGGGGGCGGG
CATGGCGCGGAGGTGGGGATGATGACGGTGAGGCCGCGGATGGACGGCCCGGGGCGGGAG
GCGCGGGTGACGAGGTACAGGGAGAAGCGGCGTACGCGGCTGTTCTCCAAGAAGATACGG
TACGAGGTGCGGAAGCTGAACGCCGAGAAACGGCCGCGGATGAAGGGCCGGTTCGTCAAG
CGCCCCTCCGCCGCCGCCGCCCCGTGCGCCGTCACCTAG

Protein

453 aa

>Os02t0731700-02 Similar to CONSTANS-like 1 protein.
MSCSSEKAAGAVGGKAARACDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERL
RLRVSSPPPLTARASVEEEAAAAVGTTTTTTSKREGGVTPAWSKRKARTRRPQVKSVGQL
LSRRLVVPEMAVESSDERKADEDGAHEELEGQLLYRVPVFDPSLAEFCSPPPIDDAAAAS
SSCFKEDAADGAVEDAKYPAAAASSPVQQLPDSFVNFEPTDAELREFAADMEALLGQGLD
DSNELQDSFYMETLGLITPPVEESGRVKMELDGGVASNSRVSLPSCRAHPKPEDVESADV
LDIDFNCTSPDEQKSSASNGAAADSQFFHRSLDLRLNYEAIIESWGNSPWTDGRPPHGQL
DDFWPNDHHYSGLWAAGGGGHGAEVGMMTVRPRMDGPGREARVTRYREKRRTRLFSKKIR
YEVRKLNAEKRPRMKGRFVKRPSAAAAPCAVT*

5'UTR

chr02:30475702..30475773 (- strand) : 72 bp

CDS

chr02:30474589..30475701 (- strand) : 1113 bp

chr02:30474249..30474494 (- strand) : 246 bp

3'UTR

chr02:30473739..30474248 (- strand) : 510 bp

FASTA

>Os02t0731700-02 class=Sequence position=chr02:30473739..30475773 (- strand)
AGAGGTTTTT TGTGGAATCA TCTTTTGTGC TGGGAGATTT CTTCTGTTTG TTCTTTTGTT TCGTCGTGAC GCATGAGCTG
CAGCTCGGAG AAGGCGGCCG GGGCCGTGGG CGGCAAGGCG GCGCGCGCGT GCGACAGCTG CCTGCGGCGG CGGGCGCGGT
GGTACTGCGC GGCGGATGAC GCCTTCCTGT GCCAGGGGTG CGACACGTCG GTGCACTCGG CCAACCCGCT CGCCAGGCGG
CACGAGCGCC TGCGCCTGCG CGTCTCGTCG CCCCCGCCGC TGACGGCGCG GGCGTCGGTG GAGGAGGAGG CGGCGGCGGC
GGTGGGGACG ACGACGACGA CGACGTCGAA GAGAGAGGGC GGCGTCACGC CGGCATGGTC GAAGCGCAAG GCGCGCACCC
GGCGCCCGCA GGTCAAGAGC GTCGGGCAGC TGCTCTCGAG GCGGCTCGTC GTGCCGGAGA TGGCGGTGGA GTCGTCGGAC
GAACGGAAGG CCGACGAAGA CGGAGCTCAC GAGGAGCTCG AGGGGCAGTT GCTGTACCGC GTTCCGGTCT TTGACCCCTC
CCTCGCCGAG TTCTGCTCGC CGCCCCCGAT CGATGACGCG GCGGCCGCAT CCTCATCGTG CTTCAAGGAG GACGCCGCCG
ACGGCGCCGT GGAAGACGCA AAGTATCCGG CAGCTGCGGC GTCGTCGCCC GTGCAGCAGC TCCCGGATAG CTTTGTCAAC
TTCGAACCGA CGGACGCCGA GCTGAGGGAG TTCGCCGCCG ACATGGAAGC CCTACTCGGA CAAGGCCTGG ACGACAGCAA
CGAGCTGCAG GACTCGTTCT ACATGGAGAC CCTAGGGCTA ATAACGCCGC CGGTAGAAGA ATCCGGCCGG GTGAAGATGG
AGCTCGACGG CGGTGTTGCC TCCAACAGCA GGGTATCTCT CCCATCATGC CGCGCTCATC CGAAGCCGGA GGACGTCGAA
TCCGCCGACG TGCTGGACAT CGATTTCAAC TGCACCTCGC CGGACGAACA GAAGTCGTCG GCGAGCAACG GCGCCGCAGC
CGATTCGCAG TTCTTCCACA GGAGCCTGGA TCTCAGGCTC AACTACGAGG CGATCATCGA GAGCTGGGGC AACTCGCCGT
GGACCGACGG CCGGCCGCCG CACGGCCAGC TCGACGACTT CTGGCCCAAC GACCACCATT ACTCGGTACG TGATTTTTGC
AATTTCAATA CCGTGTCGTC CATACTCTCA TGCTAGCGCA TGCGACATGC ATACTGAATC GAAAACTGTG TTGGTGCAGG
GGTTGTGGGC TGCGGGAGGG GGCGGGCATG GCGCGGAGGT GGGGATGATG ACGGTGAGGC CGCGGATGGA CGGCCCGGGG
CGGGAGGCGC GGGTGACGAG GTACAGGGAG AAGCGGCGTA CGCGGCTGTT CTCCAAGAAG ATACGGTACG AGGTGCGGAA
GCTGAACGCC GAGAAACGGC CGCGGATGAA GGGCCGGTTC GTCAAGCGCC CCTCCGCCGC CGCCGCCCCG TGCGCCGTCA
CCTAGACGTA CGATCGCGCA CGGCCCGGCG CGCGGCACCA TGCGTACGTG TCCGGTGTCG AGACTTGCCT GCGTTCGATC
GTATGCCTCA TGGACTCGAT TGGCACAAAA GTTCACGCAA AATTTGTCGA AGCTGCACGA TTCAAGTAGT ATAACGTTGT
TCAATTCAAA AGTTTTTCTC TTCCTTTTTT TTTTCGGTTT TGTTGGTGTT TGGCTCGGTG CTTTTGGATC TCTTTTATCT
CTGTTCCATC GACCGGAGAG AAAGTAGGCG ATTGTACTTG TGTAAACATT GGTGTTCATG GTTTTGTAGA AACACTCCAT
AAAGGAAACA AAATGACTTG TATATGTAAA CTGGGTTGTG CCTGCGCCAC ACCCATGTAC ATTGAGTAAT CAGTACATAC
TTAATTATTT TCTTGCATGT AGATAACTGG ACAAGTATCT GAAAACTTAC CGGGACGATC AAAAGTGTTC ATGATAATCA
CATTCATAAA ATCACTGCTG TAAGCATTGT CCGCT

Locus: Os02g0731700

Loading...

Locus: Os02g0731700

Loading...