Os02t0732400-01

Locus

Os02g0732400

Description

Tify domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TIFY8

CGSNL Gene Name

TIFY GENE 8

Oryzabase Gene Symbol Synonym(s)

OsJAZ12, OsTIFY8, OsSTA75

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 12

Transcript Evidence

AK107003 (DDBJ, Best hit)

Protein Evidence

B9F2J9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Tify (IPR010399)

Full-length cDNA

002-120-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0732400-01)

RiceXPro (AK107003)

Others

Oryzabase (9498)

KEGG (Os02t0732400-01)

Transcript

1475 bp

>Os02t0732400-01 Tify domain containing protein.
GCAAGCACACCCCCCGCGCGCGCGCGCGTTTCGTTCGAACGATCGATGCGCCCCGGAGCA
CACGGCACGCACCCGCGCCGCGAGAGAAGAGGAAACCAAGCGATGCCGTCGGCCCGTGAC
ACTAACATGGACTTGATGGAAGTCCTCTCGCCGCCGGCCGCCGCACGGGATCATCAGAAG
AGCCAGGTTCGTGTCCAGAGGAGCCTCTCAAGCTCTTCTGGGGTGTTTCAGGGATCTCTC
ACGTTTCTCTTTGTGGAAAAAAAAACTAGGCAAAAAAAGGGTTTGCCTAATGTAGTAAAG
CAGGGGGAGTTTGAAAGGGCTCTCTCTCACGTTGGGTAAGCTTGCCACCCGGCCCCCCCA
GGTGCACGCCGCCGCGCGTGCGCTACCGCACCAAAGCGCCAGCGTTGTCGTGGACGGACG
CATGCCGCCGCCGGCCGCCGTCGCAAGCCTGACGTTACAAGTTCCCGGAGGAGCTCACGA
TGTCACTTCTCTGGCTACTAGTCCAAGGACCATGGCCGTGCCTGGAACGACTGAACAGCT
GACGATTTTCTACTCCGGGTCTATGGTGAAGTTCGACAACGTCCCAAGGGAGAAGATTCG
CTATGCGTGCAGGCTGAGGAGGTTATATTCTTCGCTGCAAAGAAGTCTCCAGACGCAGGA
CACCAGCATGTTCCCCAGCAGCAGCAGCCTGCATATCCAAACAAAAAGAAGAGGATATTC
TGTTATCAGGCTCCTGAGAGAGATGCTGATGGTTTGTTCATCCACGAGAACAAAGCCGAT
GCTTGTTCACAGCGACAGCATCGGAGCCCAGAGGACGGGTACGCCACCATCAAGGAGACG
AATCCATGCTCGCGGCAAATCCAGATCGTGCCAAGAGATGTCTCATTGCTGGTGAAGAAT
GCGTCTCTTGTTAGCTTCCTGGAGAGCCGCAAGCAGAGGTTGGCGAGTGCAGCTTACACT
CGCCGTGAGAAATCTCCTGATGAAAAGGACATTTTTCCTACGGCTTTCCCACGAAATAAA
ACCCCACTCGGCAACACGGAACGGCATAGTGCTTTCACGAACCTGAAGAATATTAACGGA
AATCATGACGAGGAGGCACTAGATACCGAGTTGAAGATCTAGCCGCGAAGTTTTGGATTC
AGTTTGCGGCACGGGAACCTCTTGCTAATCAAGCACAAGTTTTGGACTCAGTAGGTGGAG
TGATGAACTAAGTAGAAACCTAGTGGTGCATTTGGTAGCAAGAGCCTTTTTTTTTCTTAT
TTTAATTCTGAATTTCTGATGAGGTTTTTTAAGTGCAGTAGTGATGTTCACTCGCAGTTT
CATATGAAACCGAGGCATCGTCACCCTTTTCTTCTTCTCATTGACGGGAGAAAAGGTTTT
CGGATTCGTTCGGATTGTTGCCTCTGATTACATTGATCAGATTGCACGGTCCTTTTTGTA
ACTGAGGATAGCTGAAATAAAATACTATTTTGTTT

CDS

474 bp

>Os02t0732400-01 Tify domain containing protein.
ATGCCGCCGCCGGCCGCCGTCGCAAGCCTGACGTTACAAGTTCCCGGAGGAGCTCACGAT
GTCACTTCTCTGGCTACTAGTCCAAGGACCATGGCCGTGCCTGGAACGACTGAACAGCTG
ACGATTTTCTACTCCGGGTCTATGGTGAAGTTCGACAACGTCCCAAGGGAGAAGATTCGC
TATGCGTGCAGGCTGAGGAGGTTATATTCTTCGCTGCAAAGAAGTCTCCAGACGCAGGAC
ACCAGCATGTTCCCCAGCAGCAGCAGCCTGCATATCCAAACAAAAAGAAGAGGATATTCT
GTTATCAGGCTCCTGAGAGAGATGCTGATGGTTTGTTCATCCACGAGAACAAAGCCGATG
CTTGTTCACAGCGACAGCATCGGAGCCCAGAGGACGGGTACGCCACCATCAAGGAGACGA
ATCCATGCTCGCGGCAAATCCAGATCGTGCCAAGAGATGTCTCATTGCTGGTGA

Protein

158 aa

>Os02t0732400-01 Tify domain containing protein.
MPPPAAVASLTLQVPGGAHDVTSLATSPRTMAVPGTTEQLTIFYSGSMVKFDNVPREKIR
YACRLRRLYSSLQRSLQTQDTSMFPSSSSLHIQTKRRGYSVIRLLREMLMVCSSTRTKPM
LVHSDSIGAQRTGTPPSRRRIHARGKSRSCQEMSHCW*

5'UTR

chr02:30528645..30529065 (+ strand) : 421 bp

CDS

chr02:30529066..30529151 (+ strand) : 86 bp

chr02:30529289..30529376 (+ strand) : 88 bp

chr02:30529467..30529748 (+ strand) : 282 bp

chr02:30529834..30529851 (+ strand) : 18 bp

3'UTR

chr02:30529852..30529894 (+ strand) : 43 bp

chr02:30530000..30530536 (+ strand) : 537 bp

FASTA

>Os02t0732400-01 class=Sequence position=chr02:30528645..30530536 (+ strand)
GCAAGCACAC CCCCCGCGCG CGCGCGCGTT TCGTTCGAAC GATCGATGCG CCCCGGAGCA CACGGCACGC ACCCGCGCCG
CGAGAGAAGA GGAAACCAAG CGATGCCGTC GGCCCGTGAC ACTAACATGG ACTTGATGGA AGTCCTCTCG CCGCCGGCCG
CCGCACGGGA TCATCAGAAG AGCCAGGTTC GTGTCCAGAG GAGCCTCTCA AGCTCTTCTG GGGTGTTTCA GGGATCTCTC
ACGTTTCTCT TTGTGGAAAA AAAAACTAGG CAAAAAAAGG GTTTGCCTAA TGTAGTAAAG CAGGGGGAGT TTGAAAGGGC
TCTCTCTCAC GTTGGGTAAG CTTGCCACCC GGCCCCCCCA GGTGCACGCC GCCGCGCGTG CGCTACCGCA CCAAAGCGCC
AGCGTTGTCG TGGACGGACG CATGCCGCCG CCGGCCGCCG TCGCAAGCCT GACGTTACAA GTTCCCGGAG GAGCTCACGA
TGTCACTTCT CTGGCTACTA GTCCAAGGTA TCCGTTACAT GGCCACTTCT TGGTTGGCCA AGAATGATTC TTATGTTTTC
TCTCTGAAAC AAAAACAAGA ACGAATTTCG TCTGCTACTC TGCTAGCTTT TGACGGATGG GATGCATCTG ATGATCTGAA
GCAGGACCAT GGCCGTGCCT GGAACGACTG AACAGCTGAC GATTTTCTAC TCCGGGTCTA TGGTGAAGTT CGACAACGTC
CCAAGGGAGA AGGTGTGCCT TGCTTTAATC CCTCCTCTCT CTTCTTGATC TCCCAGTCAA GCTTTGATTA TGACTTGGCC
ATACAACACT GGGGACGTGG AGATTCGCTA TGCGTGCAGG CTGAGGAGGT TATATTCTTC GCTGCAAAGA AGTCTCCAGA
CGCAGGACAC CAGCATGTTC CCCAGCAGCA GCAGCCTGCA TATCCAAACA AAAAGAAGAG GATATTCTGT TATCAGGCTC
CTGAGAGAGA TGCTGATGGT TTGTTCATCC ACGAGAACAA AGCCGATGCT TGTTCACAGC GACAGCATCG GAGCCCAGAG
GACGGGTACG CCACCATCAA GGAGACGAAT CCATGCTCGC GGCAAATCCA GATCGTGCCA AGAGGTTATT TTCCATCCTG
ATTGTGTTGA TAACCGTCTC GAAAATGATG TAATTTATGT CGTGATGTAC TGATGTTCTC CTGCAGCAGA TGTCTCATTG
CTGGTGAAGA ATGCGTCTCT TGTTAGCTTC CTGGAGAGCC GCAAGCAGAG GTAGGCAAAA AACTTGCACC AATTTATGCC
ATTTCAATCT GTTTAACTGT TCATATTTAT TTATTTATCA TAAATTTTGG TTCTTTCATT TGTTTCTGAC TTCAGGTTGG
CGAGTGCAGC TTACACTCGC CGTGAGAAAT CTCCTGATGA AAAGGACATT TTTCCTACGG CTTTCCCACG AAATAAAACC
CCACTCGGCA ACACGGAACG GCATAGTGCT TTCACGAACC TGAAGAATAT TAACGGAAAT CATGACGAGG AGGCACTAGA
TACCGAGTTG AAGATCTAGC CGCGAAGTTT TGGATTCAGT TTGCGGCACG GGAACCTCTT GCTAATCAAG CACAAGTTTT
GGACTCAGTA GGTGGAGTGA TGAACTAAGT AGAAACCTAG TGGTGCATTT GGTAGCAAGA GCCTTTTTTT TTCTTATTTT
AATTCTGAAT TTCTGATGAG GTTTTTTAAG TGCAGTAGTG ATGTTCACTC GCAGTTTCAT ATGAAACCGA GGCATCGTCA
CCCTTTTCTT CTTCTCATTG ACGGGAGAAA AGGTTTTCGG ATTCGTTCGG ATTGTTGCCT CTGATTACAT TGATCAGATT
GCACGGTCCT TTTTGTAACT GAGGATAGCT GAAATAAAAT ACTATTTTGT TT

Locus: Os02g0732400

Loading...

Locus: Os02g0732400

Loading...