Os02t0733800-01

Locus

Os02g0733800

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET13

Oryzabase Gene Name Synonym(s)

SET protein 13

Transcript Evidence

AK121645 (DDBJ, Best hit)

Protein Evidence

NP_001151430.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Rubisco LS methyltransferase, substrate-binding domain (IPR015353)

Full-length cDNA

J033058C09 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0733800-01)

RiceXPro (AK121645)

Others

Oryzabase (13379)

KEGG (Os02t0733800-01)

Transcript

1648 bp

>Os02t0733800-01 SET domain containing protein.
ATCCGAGAGCCCGTCGTCTCTTCCAGGCTTCAAGCCATCTCCACCCCCAACCAACCCCAC
TGCTCTGCTCTTCGCGCGCCTCCACCGCCGAACCCCATGGCCGCCGCCGCCGCCGCGGGG
GCGACGCCGGCGACGGCGAGGAAGGCCCTGCTCACAACAACCGCCACCCTCCTCTCCTCC
TCGCTCGCGCGCAGCCGGCGCAGCCTCTCCTGCTCCGCGGCCGCTGCCTCCGCCGCCCCG
CGCATCGCGCCTCAGCCGCCGGACCTGCTCCGATGGGTGCAGCGGGAGGGAGGGTTCGTG
CACCCCGCCCTCCGCGTGGTCGACCATCCTGAGCACGGCCTCGGGGTCTCCGCCGCCGCG
GCCGAGGGAGACATTCCCCCTGGCGACGTCCTCATCGCGCTACCCGGCCGCCTCCCTCTA
CGACTCCGCCGCCCCGCCGGCGCTGCGGACGCGGTCCTCGTGCAGCTAGCGGACCAAGTA
CCTGAGGAACTATGGGCTATGCGACTGGGCTTGAGGCTGCTTCAAGAAAGGGCAAAATCT
GATTCTTTCTGGTGGCCATATATCGCAAATCTGCCAGAGACTTTTACTGTACCGATATTT
TTTCCAGGGGAAGACATAAAAAACTTGCAGTATGCCCCTCTTCTCCACCAGGTGAATAAA
AGGTGTCGCTTCCTTCTCGAGTTTGAAAAAGAAGTGAAACATAAGCTTGGTACAGTGCCC
TTGGAAGATCATCCTTTTTGTGGACAAGATGTAAACTCATCTTCCCTTGGATGGGCTATG
TCAGCAGCATCTACTCGGGCATTCCGTTTGCATGGTGAAATCCCAATGCTGTTGCCTCTT
ATTGATATGTGTAACCATAGTTTTAACCCAAATGCTAGGATTGTCCAGGAAGGAAATGTG
GATAGCCCTGATATGTCAGTTAAGGTTGTTGCTGAGACAAAAATTGATCAAAATGCTGCG
GTAACACTGAACTATGGTTGCTACCCTAATGATTTCTTCCTTCTTGATTATGGATTTGTA
ATAACATCAAATTCGTATGATCAAGTGGAACTGAGCTATGATGGAACTCTCCTAGATGCT
GCTAGCATGGCAGCAGGAGTTTCTTCGCCTAACTTTTCAGCTCCAGCCAAGTGGCAACAG
GATATCTTGTCACAGCTAAATCTGTATGGAGAGGGTGCTATTCTAAAGGTCAGCATAGGA
GGTCCAGAAATAGTAGATGGGCGCTTATTGGCTGCTTTAAGGGTTATTATTGCAGCTGAT
CCGGACGCTGTGAGTGGCCATGACCTCAAGACTTTGATGTCTCTTAAGGAGAAAGCTCCA
TTAGGCCCAGCTGTTGAAGCTTCAGCACTCCGAACTGTCCTTGCACTTTGCACCTTTGCT
CTACAACACTTCCACACGAAGATAATGGAAGACGAGGCCATACTAAAAGGAGAACCACCT
CTTACTACTGAACTAGCCGTGCAGTTTAGATTGCAGAAGAAGCTGCTTCTCCTGGATGTG
ATACAGAATCTTAGTCGCAGAATCAAGATGCTAGCTCTAGACAAATCCACCGTGTAGGAT
TTTTCACGTTTTGGAATTGCTTTCTCGGACAATCAATTACCCTATTGTACTGATTCTGGA
GATGACAATAAAGCCCCAAATTTTGTCC

CDS

1461 bp

>Os02t0733800-01 SET domain containing protein.
ATGGCCGCCGCCGCCGCCGCGGGGGCGACGCCGGCGACGGCGAGGAAGGCCCTGCTCACA
ACAACCGCCACCCTCCTCTCCTCCTCGCTCGCGCGCAGCCGGCGCAGCCTCTCCTGCTCC
GCGGCCGCTGCCTCCGCCGCCCCGCGCATCGCGCCTCAGCCGCCGGACCTGCTCCGATGG
GTGCAGCGGGAGGGAGGGTTCGTGCACCCCGCCCTCCGCGTGGTCGACCATCCTGAGCAC
GGCCTCGGGGTCTCCGCCGCCGCGGCCGAGGGAGACATTCCCCCTGGCGACGTCCTCATC
GCGCTACCCGGCCGCCTCCCTCTACGACTCCGCCGCCCCGCCGGCGCTGCGGACGCGGTC
CTCGTGCAGCTAGCGGACCAAGTACCTGAGGAACTATGGGCTATGCGACTGGGCTTGAGG
CTGCTTCAAGAAAGGGCAAAATCTGATTCTTTCTGGTGGCCATATATCGCAAATCTGCCA
GAGACTTTTACTGTACCGATATTTTTTCCAGGGGAAGACATAAAAAACTTGCAGTATGCC
CCTCTTCTCCACCAGGTGAATAAAAGGTGTCGCTTCCTTCTCGAGTTTGAAAAAGAAGTG
AAACATAAGCTTGGTACAGTGCCCTTGGAAGATCATCCTTTTTGTGGACAAGATGTAAAC
TCATCTTCCCTTGGATGGGCTATGTCAGCAGCATCTACTCGGGCATTCCGTTTGCATGGT
GAAATCCCAATGCTGTTGCCTCTTATTGATATGTGTAACCATAGTTTTAACCCAAATGCT
AGGATTGTCCAGGAAGGAAATGTGGATAGCCCTGATATGTCAGTTAAGGTTGTTGCTGAG
ACAAAAATTGATCAAAATGCTGCGGTAACACTGAACTATGGTTGCTACCCTAATGATTTC
TTCCTTCTTGATTATGGATTTGTAATAACATCAAATTCGTATGATCAAGTGGAACTGAGC
TATGATGGAACTCTCCTAGATGCTGCTAGCATGGCAGCAGGAGTTTCTTCGCCTAACTTT
TCAGCTCCAGCCAAGTGGCAACAGGATATCTTGTCACAGCTAAATCTGTATGGAGAGGGT
GCTATTCTAAAGGTCAGCATAGGAGGTCCAGAAATAGTAGATGGGCGCTTATTGGCTGCT
TTAAGGGTTATTATTGCAGCTGATCCGGACGCTGTGAGTGGCCATGACCTCAAGACTTTG
ATGTCTCTTAAGGAGAAAGCTCCATTAGGCCCAGCTGTTGAAGCTTCAGCACTCCGAACT
GTCCTTGCACTTTGCACCTTTGCTCTACAACACTTCCACACGAAGATAATGGAAGACGAG
GCCATACTAAAAGGAGAACCACCTCTTACTACTGAACTAGCCGTGCAGTTTAGATTGCAG
AAGAAGCTGCTTCTCCTGGATGTGATACAGAATCTTAGTCGCAGAATCAAGATGCTAGCT
CTAGACAAATCCACCGTGTAG

Protein

487 aa

>Os02t0733800-01 SET domain containing protein.
MAAAAAAGATPATARKALLTTTATLLSSSLARSRRSLSCSAAAASAAPRIAPQPPDLLRW
VQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPLRLRRPAGAADAV
LVQLADQVPEELWAMRLGLRLLQERAKSDSFWWPYIANLPETFTVPIFFPGEDIKNLQYA
PLLHQVNKRCRFLLEFEKEVKHKLGTVPLEDHPFCGQDVNSSSLGWAMSAASTRAFRLHG
EIPMLLPLIDMCNHSFNPNARIVQEGNVDSPDMSVKVVAETKIDQNAAVTLNYGCYPNDF
FLLDYGFVITSNSYDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQQDILSQLNLYGEG
AILKVSIGGPEIVDGRLLAALRVIIAADPDAVSGHDLKTLMSLKEKAPLGPAVEASALRT
VLALCTFALQHFHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKMLA
LDKSTV*

5'UTR

chr02:30593495..30593590 (+ strand) : 96 bp

CDS

chr02:30593591..30593978 (+ strand) : 388 bp

chr02:30594562..30594728 (+ strand) : 167 bp

chr02:30594795..30595065 (+ strand) : 271 bp

chr02:30595291..30595556 (+ strand) : 266 bp

chr02:30595687..30596055 (+ strand) : 369 bp

3'UTR

chr02:30596056..30596146 (+ strand) : 91 bp

FASTA

>Os02t0733800-01 class=Sequence position=chr02:30593495..30596146 (+ strand)
ATCCGAGAGC CCGTCGTCTC TTCCAGGCTT CAAGCCATCT CCACCCCCAA CCAACCCCAC TGCTCTGCTC TTCGCGCGCC
TCCACCGCCG AACCCCATGG CCGCCGCCGC CGCCGCGGGG GCGACGCCGG CGACGGCGAG GAAGGCCCTG CTCACAACAA
CCGCCACCCT CCTCTCCTCC TCGCTCGCGC GCAGCCGGCG CAGCCTCTCC TGCTCCGCGG CCGCTGCCTC CGCCGCCCCG
CGCATCGCGC CTCAGCCGCC GGACCTGCTC CGATGGGTGC AGCGGGAGGG AGGGTTCGTG CACCCCGCCC TCCGCGTGGT
CGACCATCCT GAGCACGGCC TCGGGGTCTC CGCCGCCGCG GCCGAGGGAG ACATTCCCCC TGGCGACGTC CTCATCGCGC
TACCCGGCCG CCTCCCTCTA CGACTCCGCC GCCCCGCCGG CGCTGCGGAC GCGGTCCTCG TGCAGCTAGC GGACCAAGTA
CCTGGTAATG GCTCTCCTAG TCCTGGCTCA GATTTTCAAT TACCTCTGTT AGTCACGTTG TGGAAACCAG TGTGGTAGAT
TCATGTTTGT GAAGAGTTGC TAATGCATCA AAAGTAAGAT CTATTTCTAT ATAAGAATCA GGAGCATAAT TGGTATTGAT
TCTGCTGTTG ACGTCGGATC AATTGAACTG ACATCCTCCT AGTATTGCGT TTTAGTTCAG TAGCAATTTT TTCGCCAGCG
CGCAAAAGCT TTGCACGCCA ATATATTAGA GTTCAGTAGC AGTTGGGTTT TACAATTTTG AGAAATGCGG TTGTCCTGAA
CACCTAATGT CTAATGGCGA ATGCTGTTTT CTCGTGTTAA ATTGAGTAAG ATTGAGTCAG GTTTTCCTAT AATTTACGCT
ACACAACCTA ATCCTTTGTG TAGCTAATGT TGTATTTTGA CATAATTGCT GCACGATGGA ACTATTCTAC ATGTGCACTC
TATGATCCTG CCCTCTTTTA GTGTATGAGG GACTTTACAT TCTAGAAAAT TAGGCTAAGT ACCCTTCAGT GACTAACAAA
TTCAATCCTG CGGGAAGCAT GTGACAGAGG AACTATGGGC TATGCGACTG GGCTTGAGGC TGCTTCAAGA AAGGGCAAAA
TCTGATTCTT TCTGGTGGCC ATATATCGCA AATCTGCCAG AGACTTTTAC TGTACCGATA TTTTTTCCAG GGGAAGACAT
AAAAAACTTG CAGTATGCCC CTCTTCTCCA CCAGGTTGTT ATAAATTATT GTAGTTCTTA TTGCATTTCC CCTCTTCTTT
TTTGACTTAT TATATTTCAG GTGAATAAAA GGTGTCGCTT CCTTCTCGAG TTTGAAAAAG AAGTGAAACA TAAGCTTGGT
ACAGTGCCCT TGGAAGATCA TCCTTTTTGT GGACAAGATG TAAACTCATC TTCCCTTGGA TGGGCTATGT CAGCAGCATC
TACTCGGGCA TTCCGTTTGC ATGGTGAAAT CCCAATGCTG TTGCCTCTTA TTGATATGTG TAACCATAGT TTTAACCCAA
ATGCTAGGAT TGTCCAGGAA GGAAATGTGG ATAGCCCTGA TATGTCAGTT AAGGCAAGTA TCCTGAATTG TTTGTGTACT
TCTGAGCCCA AGAAATTTTG TATTTCCTTA AGACAATTTT TGTTAATTGA ATGCCCTCTG TTAGTAGCTT TGTTTATGCA
TAACAGCATA AGTGACATGT GAATGCATTT ATTTAACTGA ATTCATGGAT AAATGTAGCC TTTTATGTTA TCTTACCATA
GATGCAAGTA ACTCTGACCA CCTTGACCTT GCTTATAGGT TGTTGCTGAG ACAAAAATTG ATCAAAATGC TGCGGTAACA
CTGAACTATG GTTGCTACCC TAATGATTTC TTCCTTCTTG ATTATGGATT TGTAATAACA TCAAATTCGT ATGATCAAGT
GGAACTGAGC TATGATGGAA CTCTCCTAGA TGCTGCTAGC ATGGCAGCAG GAGTTTCTTC GCCTAACTTT TCAGCTCCAG
CCAAGTGGCA ACAGGATATC TTGTCACAGC TAAATCTGTA TGGAGAGGGT GCTATTCTAA AGGTTTTGCA CACATTCTTA
CTGATCCTAT TTATTTTTTG CAATCTATTG TTGAATTCAA GTCGTCCAGT ATCCATGCAG CAATCTGAAC CTTCTTGGTT
TTCTGTGGGT ATCACTTGTA ATTTCTTTTC AGGTCAGCAT AGGAGGTCCA GAAATAGTAG ATGGGCGCTT ATTGGCTGCT
TTAAGGGTTA TTATTGCAGC TGATCCGGAC GCTGTGAGTG GCCATGACCT CAAGACTTTG ATGTCTCTTA AGGAGAAAGC
TCCATTAGGC CCAGCTGTTG AAGCTTCAGC ACTCCGAACT GTCCTTGCAC TTTGCACCTT TGCTCTACAA CACTTCCACA
CGAAGATAAT GGAAGACGAG GCCATACTAA AAGGAGAACC ACCTCTTACT ACTGAACTAG CCGTGCAGTT TAGATTGCAG
AAGAAGCTGC TTCTCCTGGA TGTGATACAG AATCTTAGTC GCAGAATCAA GATGCTAGCT CTAGACAAAT CCACCGTGTA
GGATTTTTCA CGTTTTGGAA TTGCTTTCTC GGACAATCAA TTACCCTATT GTACTGATTC TGGAGATGAC AATAAAGCCC
CAAATTTTGT CC

Locus: Os02g0733800

Loading...

Locus: Os02g0733800

Loading...