Os02t0742200-01

Locus

Os02g0742200

Description

Small GTP-binding protein OsRac3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC3

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 3

Oryzabase Gene Symbol Synonym(s)

OsRac3

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 3, Rac-like GTP-binding protein 3

Transcript Evidence

AK069345 (DDBJ, Best hit)

Protein Evidence

Q6Z808 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

J023012K16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0742200-01)

Others

Oryzabase (6290)

Transcript

1246 bp

>Os02t0742200-01 Small GTP-binding protein OsRac3.
ACTCTCTAGGCAGGCAACGGCAGCACAGGCACAGCAGCAGCGTGGTGGTGAGAGTGAGAA
GCATGTGACCCCTCTTAAAAACACTTCGCCGAGAAGTCACGCACCAAACACCACCAAGAA
CGAACAACTCTTCTCCCCCTCTCCCCCTCCTTCCTTGCTCCTCCTCCCATCTTGTCTCCT
CCCTCTCTCTCGCAAAGTCGCAACGCGCTCCTCCTCGGTGAAACGGGAGTGAGGTGCGTG
CGGCCATGGCGTCCAGCGCCTCCCGGTTCATCAAGTGCGTCACGGTGGGCGACGGCGCCG
TGGGCAAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGACTACATAC
CAACGGTGTTCGACAATTTCAGCGCAAACGTTGTTGTGGACAGCACCACGGTGAATCTGG
GCCTCTGGGATACTGCTGGGCAAGAGGATTACAACCGGCTCAGGCCTCTGAGCTATCGTG
GTGCTGATGTTTTCGTGCTTGCCTTCTCTCTTGTGAGCCGAGCTAGCTATGAAAATATTA
TGAAGAAGTGGATACCGGAGCTACAGCATTATGCACCCGGCGTGCCCATTGTGTTGGTTG
GCACAAAATTGGATCTCCGTGAAGACAAGCACTACTTGTTGGACCATCCTGGCATGATAC
CTGTTACCACAGCACAGGGTGAAGAACTTCGAAAACAAATAGGTGCTGCTTATTACATTG
AGTGCAGCTCAAAGACACAACAGAATGTCAAAGGTGTGTTTGATGCTGCTATCAAGGTAG
TAATCCAGCCTCCAACTAAGCAGAGGGAAAAGAAGAAAAAGAAATCACGACAAGGATGCT
CTATGATGAACATGTTCCGTGGAAGGAAAATGTCATGCTTCAAATCCTGATTGATCGAGA
TGTCCCTTACATGATGCAATGTTCTGGGTGCAACCTCAAGCTGGCAACCTTTGGAGTCTG
AATGTGCTGGTAGAGTTAGATGCAAAGTTCTTGTGTATATTTGCATCTTTTGGTAATTAA
TTACTAGAGTTAGATGGTTAAACTAGTCTGCTTATGTACCGCACAATGCTCTTATTATTA
GCTCTTGTTGGTCTAGAAAGTCTGATAGATGCCAAAGGAACAAGGAGACACCGTTCTGTC
AGGACAAAATCACAGATTTTGTAATCGATCTGAAGTCTCAGTATCGTCATTAGAACATTT
TATGATTCGATGGTAGAACTGAAAGCAGCAACTACAAAGCTCGCCG

CDS

645 bp

>Os02t0742200-01 Small GTP-binding protein OsRac3.
ATGGCGTCCAGCGCCTCCCGGTTCATCAAGTGCGTCACGGTGGGCGACGGCGCCGTGGGC
AAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGACTACATACCAACG
GTGTTCGACAATTTCAGCGCAAACGTTGTTGTGGACAGCACCACGGTGAATCTGGGCCTC
TGGGATACTGCTGGGCAAGAGGATTACAACCGGCTCAGGCCTCTGAGCTATCGTGGTGCT
GATGTTTTCGTGCTTGCCTTCTCTCTTGTGAGCCGAGCTAGCTATGAAAATATTATGAAG
AAGTGGATACCGGAGCTACAGCATTATGCACCCGGCGTGCCCATTGTGTTGGTTGGCACA
AAATTGGATCTCCGTGAAGACAAGCACTACTTGTTGGACCATCCTGGCATGATACCTGTT
ACCACAGCACAGGGTGAAGAACTTCGAAAACAAATAGGTGCTGCTTATTACATTGAGTGC
AGCTCAAAGACACAACAGAATGTCAAAGGTGTGTTTGATGCTGCTATCAAGGTAGTAATC
CAGCCTCCAACTAAGCAGAGGGAAAAGAAGAAAAAGAAATCACGACAAGGATGCTCTATG
ATGAACATGTTCCGTGGAAGGAAAATGTCATGCTTCAAATCCTGA

Protein

215 aa

>Os02t0742200-01 Small GTP-binding protein OsRac3.
MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGL
WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGT
KLDLREDKHYLLDHPGMIPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAAIKVVI
QPPTKQREKKKKKSRQGCSMMNMFRGRKMSCFKS*

5'UTR

chr02:31087940..31088184 (- strand) : 245 bp

CDS

chr02:31087835..31087939 (- strand) : 105 bp

chr02:31087393..31087480 (- strand) : 88 bp

chr02:31087136..31087245 (- strand) : 110 bp

chr02:31086963..31087026 (- strand) : 64 bp

chr02:31086039..31086103 (- strand) : 65 bp

chr02:31085804..31085869 (- strand) : 66 bp

chr02:31085582..31085685 (- strand) : 104 bp

chr02:31084824..31084866 (- strand) : 43 bp

3'UTR

chr02:31084468..31084823 (- strand) : 356 bp

FASTA

>Os02t0742200-01 class=Sequence position=chr02:31084468..31088184 (- strand)
ACTCTCTAGG CAGGCAACGG CAGCACAGGC ACAGCAGCAG CGTGGTGGTG AGAGTGAGAA GCATGTGACC CCTCTTAAAA
ACACTTCGCC GAGAAGTCAC GCACCAAACA CCACCAAGAA CGAACAACTC TTCTCCCCCT CTCCCCCTCC TTCCTTGCTC
CTCCTCCCAT CTTGTCTCCT CCCTCTCTCT CGCAAAGTCG CAACGCGCTC CTCCTCGGTG AAACGGGAGT GAGGTGCGTG
CGGCCATGGC GTCCAGCGCC TCCCGGTTCA TCAAGTGCGT CACGGTGGGC GACGGCGCCG TGGGCAAGAC CTGCATGCTC
ATCTGCTACA CCAGCAACAA GTTCCCCACT GTAAAGCAAA TCTTTCTCCT TCTCATTCTC TTCTTTTCTT TTGTTTTCTC
CTCTCTCTCC CCCTTCCCTG TTGCTGTATC AGGATTTTTT GGGTGCAAAA GACTTGATCT TTCTTGATCG GTTTCTTGCC
AAACGAGTAG GAACTTTCGT TTGGAGTCAA AAGGCTTCCT CTACTTCCTT TTTTTTGCTG ATTTTGTTTT CTTGAAGTTA
CACAGAATTT CGATTTTTCT CGGTATATTT TTGTTGGAGG TGTTTCCTTG TAGCGGGTAT TTTTGCTCCG TTCTTGTAGT
GAATTTTGGA TAATTATCAC TGTTTTTTTA AAAAAAAAAA TCTGACGGGC ATTTGATTTG GCAGGACTAC ATACCAACGG
TGTTCGACAA TTTCAGCGCA AACGTTGTTG TGGACAGCAC CACGGTGAAT CTGGGCCTCT GGGATACTGC TGGTAATTTC
AGTTCCTGAT TTGATTGCTT TGTATTTCCT GGAATTCAAG ATTCTTTTCT CCCCTTTTCA ATTATTTATT CTGGTTGAAA
ATTTTGCGTT TCGGTGATTC TTTGATAACG TAAAACTAAC ATGATGCAAT CTTTTCCAGG GCAAGAGGAT TACAACCGGC
TCAGGCCTCT GAGCTATCGT GGTGCTGATG TTTTCGTGCT TGCCTTCTCT CTTGTGAGCC GAGCTAGCTA TGAAAATATT
ATGAAGAAGG TACTGAATGT GCCATTTTGA CTTCTTGGAC TTGTCCTTGC GGTATATTTT TGTTTGTTTG AAAATACTAA
GATATGTGTA TTTTGTGTGC TTTGTTCTTC CCTTTCAGTG GATACCGGAG CTACAGCATT ATGCACCCGG CGTGCCCATT
GTGTTGGTTG GCACAAAATT GGGTGAGTTT TGTTGACAAG AAAAACATTT GTTTCAATTA AACTGCATGT CGATGATTAG
AAATGGGAAT TGGGGCTGTA GTATGATATA CATCTAATCA CCTTATGTAG TAGTTAGCAT CTTTTTGTCT CTGTGGTTTG
GAGTTCAGTT AGGTTTTCAA TCTACTGGTA GTGGTTTTAT AATTAGGTTT TCAATCTACT GATAGTGGTC CTTGTAATGT
AGACACAGGT TATATTATGT GTAGTTGATG ACCAAACAGT AGGTAAGGAG CTTACCTAGA ACTGCTCTAT CTGGTGCATC
TTACTAAATG CGCAATACAA TTATCGGTGT AGTTGATAAC CAAATAGCAG GTAACGAACT GACCTAGAAC TGCTCTTTCT
AGTGCAGCTT ACTAAAAGTG TAGACAGTCA TCTAGATAGC TGGTCACAAA ATAGTTGTTG GTATGGAACT CACCTAAAAG
GCTAAAACTG CTCTTTCTAG TGCAGCTTAG TGGATGCTCC GAAGTTATTT TTGAAATTGC ATGCATTATG TGTTTATACT
TTATACGCAA TAATGGGAAA GTCAGTTATG TTGGAGTATG AATCATTTAT GAGATAAGAG TACAAAACCC ATGAATATAG
ACTAGCAGTT TTCATAAAAC CAATTGTAAT CATGATTTCT TATTCCTGTC AAAACCATTT CAATTCTGCT GGAATTTTGA
ATCCTTGTAT CCTAACAAAA CCATTTCAAT TCTGCTGGCA TGTGGAATCC TGGTATCCTA TCAAAACCTT GGTCTAATAT
CATGTTTTGA GTATCTTATT GAATTTCTGT TAATTATAGT GTTAGTTTTG GAAATCATCT TGTTGTTTAA TTGGCTTACA
GATCTCCGTG AAGACAAGCA CTACTTGTTG GACCATCCTG GCATGATACC TGTTACCACA GCACAGGTAT ATCTCTAGTG
ACTTTATTGA TTGGTGAGAA ACCAGAGCGT TATAACTTTG GTTATCCTTA TTTGTCAGCC TTTTGAGAGG AAATGTTGAA
ACACATTCTA GCTTTTAAAA AGTCTGTCTT CTTTGAGATG ACTAAAAAAA ATGTCTCTGA TATTTCCTCT TGTAGGGTGA
AGAACTTCGA AAACAAATAG GTGCTGCTTA TTACATTGAG TGCAGCTCAA AGACACAACA GGTAAAATAG TCATAGTGAA
ATGGTGTGCC CTTGCTGTAG TAGTCTTAAC TTCATTTGAA CCGTTAAAAT TCTGCGACTT GCTGAAATTC TTACTTTGTT
GTATTTAAAT GACGCGCAGA ATGTCAAAGG TGTGTTTGAT GCTGCTATCA AGGTAGTAAT CCAGCCTCCA ACTAAGCAGA
GGGAAAAGAA GAAAAAGAAA TCACGACAAG GATGCTCTAT GATGTAAGTA TATATGATTC TGTGATGGGT GTTTGCATCA
CTGCAATTCT TCTTTAGGAT GTATCCCGTC TATATAAAAG AACCTAGCTT TTGTGGTGGT GGTGGTGAGT CTTATTATCC
CATGAGTCCA TGATCTCTTT ATTTTGGCTG GTCGTAACTC GTAAGGCTAT CTATGGACAT TGATTTTCTA TATGCCTTTT
GTCCTACAAT ATATATAAGT TTAGATCTTA TGATATACAC CCTTTGTCCA AATTCATGTG GTGTTCTTGT CTTTCAAGAG
TCAAAACTTT GTAAAATCGG CTAAAAAGTA TAGGTTTGTT TATGCAAATG TGATATCCCT TGATTGTATT TCAACATACT
ACATATGATC ATAAGTTTTT GTCGGTAGAA ATATATTGCA AAAGAAATTT CTGGTCGAAG TTAATTAAAG ATCATGACAG
ATCAAATACA TGCCATGTAA AAAGGGTGAA TGCCCTTTTT TGTATTACTA AGAGTTATTC ACAAGATTGT TAACAGTTGT
CCACGATGAA AAAATTGACC ATGAATGTTT ATTCACCCTA GATGCATGCT TGATGTATAT TTGTATGTTT TGTTTTGCTT
TCTAAATTTA ATTTCTCGTT TGCACCTCCA CCAAAAAAAA AGGGATTTAA AGAAAAACTA AGGCATGGAG TCCGAAACGG
CATCCTTTAA ATGTTAATTT CGTGCCTTAC AACTGCAGGA ACATGTTCCG TGGAAGGAAA ATGTCATGCT TCAAATCCTG
ATTGATCGAG ATGTCCCTTA CATGATGCAA TGTTCTGGGT GCAACCTCAA GCTGGCAACC TTTGGAGTCT GAATGTGCTG
GTAGAGTTAG ATGCAAAGTT CTTGTGTATA TTTGCATCTT TTGGTAATTA ATTACTAGAG TTAGATGGTT AAACTAGTCT
GCTTATGTAC CGCACAATGC TCTTATTATT AGCTCTTGTT GGTCTAGAAA GTCTGATAGA TGCCAAAGGA ACAAGGAGAC
ACCGTTCTGT CAGGACAAAA TCACAGATTT TGTAATCGAT CTGAAGTCTC AGTATCGTCA TTAGAACATT TTATGATTCG
ATGGTAGAAC TGAAAGCAGC AACTACAAAG CTCGCCG

Locus: Os02g0742200

Loading...

Locus: Os02g0742200

Loading...