Os02t0742200-02

Locus

Os02g0742200

Description

Small GTP-binding protein OsRac3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC3

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 3

Oryzabase Gene Symbol Synonym(s)

OsRac3

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 3, Rac-like GTP-binding protein 3

Transcript Evidence

AK059970 (DDBJ, Best hit)

Protein Evidence

Q6Z808 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

006-211-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0742200-02)

Others

Oryzabase (6290)

Transcript

1156 bp

>Os02t0742200-02 Small GTP-binding protein OsRac3.
AAACACCACCAAGAACGAACAACTCTTCTCCCCCTCTCCCCCTCCTTCCTTGCTCCTCCT
CCCATCTTGTCTCCTCCCTCTCTCTCGCAAAGTCGCAACGCGCTCCTCCTCGGTGAAACG
GGAGTGAGGTGCGTGCGGCCATGGCGTCCAGCGCCTCCCGGTTCATCAAGTGCGTCACGG
TGGGCGACGGCGCCGTGGGCAAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCC
CCACTGACTACATACCAACGGTGTTCGACAATTTCAGCGCAAACGTTGTTGTGGACAGCA
CCACGGTGAATCTGGGCCTCTGGGATACTGCTGGGCAAGAGGATTACAACCGGCTCAGGC
CTCTGAGCTATCGTGGTGCTGATGTTTTCGTGCTTGCCTTCTCTCTTGTGAGCCGAGCTA
GCTATGAAAATATTATGAAGAAGTGGATACCGGAGCTACAGCATTATGCACCCGGCGTGC
CCATTGTGTTGGTTGGCACAAAATTGGATCTCCGTGAAGACAAGCACTACTTGTTGGACC
ATCCTGGCATGATACCTGTTACCACAGCACAGGGTGAAGAACTTCGAAAACAAATAGGTG
CTGCTTATTACATTGAGTGCAGCTCAAAGACACAACAGAATGTCAAAGGTGTGTTTGATG
CTGCTATCAAGGTAGTAATCCAGCCTCCAACTAAGCAGAGGGAAAAGAAGAAAAAGAAAT
CACGACAAGGATGCTCTATGATGAACATGTTCCGTGGAAGGAAAATGTCATGCTTCAAAT
CCTGATTGATCGAGATGTCCCTTACATGATGCAATGTTCTGGGTGCAACCTCAAGCTGGC
AACCTTTGGAGTCTGAATGTGCTGGTAGAGTTAGATGCAAAGTTCTTGTGTATATTTGCA
TCTTTTGGTAATTAATTACTAGAGTTAGATGGTTAAACTAGTCTGCTTATGTACCGCACA
ATGCTCTTATTATTAGCTCTTGTTGGTCTAGAAAGTCTGATAGATGCCAAAGGAACAAGG
AGACACCGTTCTGTCAGGACAAAATCACAGATTTTGTAATCGATCTGAAGTCTCAGTATC
GTCATTAGAACATTTTATGATTCGATGGTAGAACTGAAAGCAGCAACTACAAAGCTCGCC
GTCCCTAGTGTTTTGT

CDS

645 bp

>Os02t0742200-02 Small GTP-binding protein OsRac3.
ATGGCGTCCAGCGCCTCCCGGTTCATCAAGTGCGTCACGGTGGGCGACGGCGCCGTGGGC
AAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGACTACATACCAACG
GTGTTCGACAATTTCAGCGCAAACGTTGTTGTGGACAGCACCACGGTGAATCTGGGCCTC
TGGGATACTGCTGGGCAAGAGGATTACAACCGGCTCAGGCCTCTGAGCTATCGTGGTGCT
GATGTTTTCGTGCTTGCCTTCTCTCTTGTGAGCCGAGCTAGCTATGAAAATATTATGAAG
AAGTGGATACCGGAGCTACAGCATTATGCACCCGGCGTGCCCATTGTGTTGGTTGGCACA
AAATTGGATCTCCGTGAAGACAAGCACTACTTGTTGGACCATCCTGGCATGATACCTGTT
ACCACAGCACAGGGTGAAGAACTTCGAAAACAAATAGGTGCTGCTTATTACATTGAGTGC
AGCTCAAAGACACAACAGAATGTCAAAGGTGTGTTTGATGCTGCTATCAAGGTAGTAATC
CAGCCTCCAACTAAGCAGAGGGAAAAGAAGAAAAAGAAATCACGACAAGGATGCTCTATG
ATGAACATGTTCCGTGGAAGGAAAATGTCATGCTTCAAATCCTGA

Protein

215 aa

>Os02t0742200-02 Small GTP-binding protein OsRac3.
MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGL
WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVLVGT
KLDLREDKHYLLDHPGMIPVTTAQGEELRKQIGAAYYIECSSKTQQNVKGVFDAAIKVVI
QPPTKQREKKKKKSRQGCSMMNMFRGRKMSCFKS*

5'UTR

chr02:31087940..31088079 (- strand) : 140 bp

CDS

chr02:31087835..31087939 (- strand) : 105 bp

chr02:31087393..31087480 (- strand) : 88 bp

chr02:31087136..31087245 (- strand) : 110 bp

chr02:31086963..31087026 (- strand) : 64 bp

chr02:31086039..31086103 (- strand) : 65 bp

chr02:31085804..31085869 (- strand) : 66 bp

chr02:31085582..31085685 (- strand) : 104 bp

chr02:31084824..31084866 (- strand) : 43 bp

3'UTR

chr02:31084453..31084823 (- strand) : 371 bp

FASTA

>Os02t0742200-02 class=Sequence position=chr02:31084453..31088079 (- strand)
AAACACCACC AAGAACGAAC AACTCTTCTC CCCCTCTCCC CCTCCTTCCT TGCTCCTCCT CCCATCTTGT CTCCTCCCTC
TCTCTCGCAA AGTCGCAACG CGCTCCTCCT CGGTGAAACG GGAGTGAGGT GCGTGCGGCC ATGGCGTCCA GCGCCTCCCG
GTTCATCAAG TGCGTCACGG TGGGCGACGG CGCCGTGGGC AAGACCTGCA TGCTCATCTG CTACACCAGC AACAAGTTCC
CCACTGTAAA GCAAATCTTT CTCCTTCTCA TTCTCTTCTT TTCTTTTGTT TTCTCCTCTC TCTCCCCCTT CCCTGTTGCT
GTATCAGGAT TTTTTGGGTG CAAAAGACTT GATCTTTCTT GATCGGTTTC TTGCCAAACG AGTAGGAACT TTCGTTTGGA
GTCAAAAGGC TTCCTCTACT TCCTTTTTTT TGCTGATTTT GTTTTCTTGA AGTTACACAG AATTTCGATT TTTCTCGGTA
TATTTTTGTT GGAGGTGTTT CCTTGTAGCG GGTATTTTTG CTCCGTTCTT GTAGTGAATT TTGGATAATT ATCACTGTTT
TTTTAAAAAA AAAAATCTGA CGGGCATTTG ATTTGGCAGG ACTACATACC AACGGTGTTC GACAATTTCA GCGCAAACGT
TGTTGTGGAC AGCACCACGG TGAATCTGGG CCTCTGGGAT ACTGCTGGTA ATTTCAGTTC CTGATTTGAT TGCTTTGTAT
TTCCTGGAAT TCAAGATTCT TTTCTCCCCT TTTCAATTAT TTATTCTGGT TGAAAATTTT GCGTTTCGGT GATTCTTTGA
TAACGTAAAA CTAACATGAT GCAATCTTTT CCAGGGCAAG AGGATTACAA CCGGCTCAGG CCTCTGAGCT ATCGTGGTGC
TGATGTTTTC GTGCTTGCCT TCTCTCTTGT GAGCCGAGCT AGCTATGAAA ATATTATGAA GAAGGTACTG AATGTGCCAT
TTTGACTTCT TGGACTTGTC CTTGCGGTAT ATTTTTGTTT GTTTGAAAAT ACTAAGATAT GTGTATTTTG TGTGCTTTGT
TCTTCCCTTT CAGTGGATAC CGGAGCTACA GCATTATGCA CCCGGCGTGC CCATTGTGTT GGTTGGCACA AAATTGGGTG
AGTTTTGTTG ACAAGAAAAA CATTTGTTTC AATTAAACTG CATGTCGATG ATTAGAAATG GGAATTGGGG CTGTAGTATG
ATATACATCT AATCACCTTA TGTAGTAGTT AGCATCTTTT TGTCTCTGTG GTTTGGAGTT CAGTTAGGTT TTCAATCTAC
TGGTAGTGGT TTTATAATTA GGTTTTCAAT CTACTGATAG TGGTCCTTGT AATGTAGACA CAGGTTATAT TATGTGTAGT
TGATGACCAA ACAGTAGGTA AGGAGCTTAC CTAGAACTGC TCTATCTGGT GCATCTTACT AAATGCGCAA TACAATTATC
GGTGTAGTTG ATAACCAAAT AGCAGGTAAC GAACTGACCT AGAACTGCTC TTTCTAGTGC AGCTTACTAA AAGTGTAGAC
AGTCATCTAG ATAGCTGGTC ACAAAATAGT TGTTGGTATG GAACTCACCT AAAAGGCTAA AACTGCTCTT TCTAGTGCAG
CTTAGTGGAT GCTCCGAAGT TATTTTTGAA ATTGCATGCA TTATGTGTTT ATACTTTATA CGCAATAATG GGAAAGTCAG
TTATGTTGGA GTATGAATCA TTTATGAGAT AAGAGTACAA AACCCATGAA TATAGACTAG CAGTTTTCAT AAAACCAATT
GTAATCATGA TTTCTTATTC CTGTCAAAAC CATTTCAATT CTGCTGGAAT TTTGAATCCT TGTATCCTAA CAAAACCATT
TCAATTCTGC TGGCATGTGG AATCCTGGTA TCCTATCAAA ACCTTGGTCT AATATCATGT TTTGAGTATC TTATTGAATT
TCTGTTAATT ATAGTGTTAG TTTTGGAAAT CATCTTGTTG TTTAATTGGC TTACAGATCT CCGTGAAGAC AAGCACTACT
TGTTGGACCA TCCTGGCATG ATACCTGTTA CCACAGCACA GGTATATCTC TAGTGACTTT ATTGATTGGT GAGAAACCAG
AGCGTTATAA CTTTGGTTAT CCTTATTTGT CAGCCTTTTG AGAGGAAATG TTGAAACACA TTCTAGCTTT TAAAAAGTCT
GTCTTCTTTG AGATGACTAA AAAAAATGTC TCTGATATTT CCTCTTGTAG GGTGAAGAAC TTCGAAAACA AATAGGTGCT
GCTTATTACA TTGAGTGCAG CTCAAAGACA CAACAGGTAA AATAGTCATA GTGAAATGGT GTGCCCTTGC TGTAGTAGTC
TTAACTTCAT TTGAACCGTT AAAATTCTGC GACTTGCTGA AATTCTTACT TTGTTGTATT TAAATGACGC GCAGAATGTC
AAAGGTGTGT TTGATGCTGC TATCAAGGTA GTAATCCAGC CTCCAACTAA GCAGAGGGAA AAGAAGAAAA AGAAATCACG
ACAAGGATGC TCTATGATGT AAGTATATAT GATTCTGTGA TGGGTGTTTG CATCACTGCA ATTCTTCTTT AGGATGTATC
CCGTCTATAT AAAAGAACCT AGCTTTTGTG GTGGTGGTGG TGAGTCTTAT TATCCCATGA GTCCATGATC TCTTTATTTT
GGCTGGTCGT AACTCGTAAG GCTATCTATG GACATTGATT TTCTATATGC CTTTTGTCCT ACAATATATA TAAGTTTAGA
TCTTATGATA TACACCCTTT GTCCAAATTC ATGTGGTGTT CTTGTCTTTC AAGAGTCAAA ACTTTGTAAA ATCGGCTAAA
AAGTATAGGT TTGTTTATGC AAATGTGATA TCCCTTGATT GTATTTCAAC ATACTACATA TGATCATAAG TTTTTGTCGG
TAGAAATATA TTGCAAAAGA AATTTCTGGT CGAAGTTAAT TAAAGATCAT GACAGATCAA ATACATGCCA TGTAAAAAGG
GTGAATGCCC TTTTTTGTAT TACTAAGAGT TATTCACAAG ATTGTTAACA GTTGTCCACG ATGAAAAAAT TGACCATGAA
TGTTTATTCA CCCTAGATGC ATGCTTGATG TATATTTGTA TGTTTTGTTT TGCTTTCTAA ATTTAATTTC TCGTTTGCAC
CTCCACCAAA AAAAAAGGGA TTTAAAGAAA AACTAAGGCA TGGAGTCCGA AACGGCATCC TTTAAATGTT AATTTCGTGC
CTTACAACTG CAGGAACATG TTCCGTGGAA GGAAAATGTC ATGCTTCAAA TCCTGATTGA TCGAGATGTC CCTTACATGA
TGCAATGTTC TGGGTGCAAC CTCAAGCTGG CAACCTTTGG AGTCTGAATG TGCTGGTAGA GTTAGATGCA AAGTTCTTGT
GTATATTTGC ATCTTTTGGT AATTAATTAC TAGAGTTAGA TGGTTAAACT AGTCTGCTTA TGTACCGCAC AATGCTCTTA
TTATTAGCTC TTGTTGGTCT AGAAAGTCTG ATAGATGCCA AAGGAACAAG GAGACACCGT TCTGTCAGGA CAAAATCACA
GATTTTGTAA TCGATCTGAA GTCTCAGTAT CGTCATTAGA ACATTTTATG ATTCGATGGT AGAACTGAAA GCAGCAACTA
CAAAGCTCGC CGTCCCTAGT GTTTTGT

Locus: Os02g0742200

Loading...

Locus: Os02g0742200

Loading...