Os02t0744700-01

Locus

Os02g0744700

Description

Similar to Starch synthase isoform zSTSII-2 (EC 2.4.1.21).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SSIIB

CGSNL Gene Name

SOLUBLE STARCH SYNTHASE IIB

Oryzabase Gene Symbol Synonym(s)

OsSSIIb, OsSSII-2, SSII-2, SS2, OsSSSIIb, SS2b

Oryzabase Gene Name Synonym(s)

Starch synthase-IIb, starch synthase IIb, "Soluble starch synthase 2-2, chloroplastic/amyloplastic", Soluble starch synthase II-2, Starch synthase isoform zSTSII-2

Transcript Evidence

AK066446 (DDBJ, Best hit)

Protein Evidence

D0TZP8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: glucan biosynthetic process (GO:0009250)

Molecular Function: starch synthase activity (GO:0009011)

Functional domain (InterPro)

Glycosyl transferase, family 1 (IPR001296)

Glycogen/starch synthases, ADP-glucose type (IPR011835)

Starch synthase, catalytic domain (IPR013534)

Full-length cDNA

J013060C10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0744700-01)

RiceXPro (AK066446)

Others

Oryzabase (8103)

KEGG (Os02t0744700-01 (EC:2.4.1.21))

Transcript

2644 bp

>Os02t0744700-01 Similar to Starch synthase isoform zSTSII-2 (EC 2.4.1.21).
AATCTCTTTTCTCTCGTCGTCGTCTCGTCTTCCCACCTCTCGGATTCCCGAGCTCCACAC
GACACGACCCACCTCGGCCACTCTCCGCCGTCGGTGGCCAGTGGCCTCCACCCCCTCCGT
CCCCCGGGGACCACACCGGCGTAACATCAGCCACACCTCCGGCAGATCTTTCCCCCGCCG
CTTAATTCACCTCCTCTTCGCCGCGGCGCAGGCGGAGCAGGGTGAGCGGGGTTTGGTGGC
ACTTGTATGGTGGCACGGGGCTGCGGTTGCATTGGGAGCGGCGGGGTTTGGTTCGGGACG
GAGCCGTCGTGTGCTCGGCGTCGGCCGCCGGTGGTGAGGATGGCGTCGCGAAGGCGAAGA
CGAAGTCAGCGGGGAGCTCGAAGGCGGTCGCTGTGCAGGGCAGCACGGCCAAGGCTGATC
ATGTTGAGGATTCAGTTTCATCACCCAAATACGTGAAACCTGCCGTTGCGAAGCAAAATG
GAGAGGTTGTGAGCAGAGCTACCAAATCTGATGCACCAGTGTCTAAACCCAAAGTTGACC
CGTCAGTTCCTGCTTCCAAGGCTGAAGCTGATGGTAATGCACAAGCTGTGGAATCGAAGG
CTGCACTGGACAAGAAGGAAGACGTCGGTGTTGCTGAACCGTTGGAAGCTAAGGCTGATG
CTGGTGGAGATGCAGGTGCAGTAAGCTCTGCAGATGATAGTGAGAACAAGGAATCTGGTC
CATTGGCAGGGCCAAATGTGATGAATGTCATTGTGGTGGCTTCTGAATGTTCTCCTTTCT
GTAAAACAGGTGGTCTTGGAGATGTTGTGGGTGCTTTGCCTAAGGCTCTGGCAAGAAGAG
GACATCGTGTTATGGTTGTGATACCAAGATACGGAGAATATGCAGAAGCCAAGGATCTAG
GTGTCCGCAAACGTTACAGGGTAGCTGGACAGGATTCAGAAGTGAGTTATTTTCATGCTT
TTATCGATGGTGTTGATTTTGTGTTTCTAGAGGCCCCTCCCTTTCGACACCGGCACAATG
ATATTTATGGAGGAGAAAGATTTGATGTTTTGAAGCGTATGATTTTGTTCTGCAAAGCTG
CTGTTGAGGTTCCTTGGTTTGCTCCATGTGGTGGTTCCATCTACGGTGATGGCAATTTAG
TCTTCATTGCAAATGATTGGCATACTGCACTTTTACCCGTATATTTGAAGGCATATTACC
GAGATAATGGCTTGATGCAGTATACTCGCTCTGTTCTTGTGATACACAACATTGCTCATC
AGGGTCGTGGCCCTGTAGATGACTTCGCCACGATGGACTTGCCCGAGCACTACATCGATC
ATTTCAGACTGTACGACCCCGTCGGCGGTGAGCACAGCAACGTGTTCGCCGCTGGCCTGA
AGATGGCTGACCGCGCGGTCACCGTCAGCCATGGCTATCTGTGGGAGATCAAGACAATGG
ACGGTGGCTGGGGCCTCCACGAGATAATAAACCACAACGACTGGAAGCTGCAGGGCATCG
TGAACGGCATCGACATGGCCGAATGGAACCCCGAGGTGGACGAGCACCTGCAGTCCGACG
GCTACGCCAACTACACGTTCGAGACGCTGGACACCGGCAAGAAACAGTGCAAGGAGGCGC
TGCAGCGGCAGCTGGGCCTGCAGGTCCGCGACGACGTGCCGCTGATCGGGTTCATCGGGC
GGCTCGACCACCAGAAGGGCGTGGACATCAtcggcgacgcgatgccgtggatcgccgggc
aggacgtgcaggtggtgatgctgggcacggggcggccggacctggaggagatgctgcggc
ggttcgagtcgGAGCACAACGACAAGGTGCGCGGGTGGGTGGGGTTCTCGGTGCAGCTGG
CGCACCGGATCACGGCGGGCGCCGACGTCCTCCTGATGCCGTCGCGGTTCGAGCCGTGCG
GGCTGAACCAGCTGTACGCCATGGCGTACGGCACCGTGCCCGTGGTGCACGCCGTGGGCG
GGCTCCGCGACACGGTGGCGCCGTTCGACCCGTTCGCCGACACGGGGCTCGGGTGGACGT
TCGACCGCGCCGAGGCGAACCGGATGATCGACGCGCTCGGGCACTGCCTCAACACGTACC
GGAACTACAAGGAGAGCTGGAGGGGGCTCCAGGCGCGCGGCATGGCGCAGGACCTCAGCT
GGGACCACGCCGCCGAGCTCTACGAGGACGTCCTCGTCAAGGCCAAGTACCAGTGGTGAG
CTGGTGGTATTTTTCGCGACGCCTCTGGATCCCGCCGTGGATGGGCGCGCTTTTTCTCTA
GGGCGGCTCTGCGTCGGAGACGCTCAGACGCATCGCGCGCGTTCGCGCCCACACGATGAC
TGGCACGCTGCTGCTGAGACGGCGGCACGCGATGCCATCATGCCACCGGACGGTAGGAGC
AACGGTGGAAGTGAACTGTACTACTGGTGCTACACTGCTACTACATGAGATCTGCTCTTA
TTGGTCACGTACTCACGTTCACGCTGAATTACCGAATGTGTTGTGTCTTGTGTGTGTGTG
TTAAAGGCATTGTCCTGGTAAATGGTGGAGACGAGATGGCCGGGTCGCGGGAGTTATATT
TGTATATGTTGCCAGCTTTCTGAGTTTTTCAAGCCAGTGCGGCTCTTCAGTGCAGGTTCC
AAGC

CDS

2034 bp

>Os02t0744700-01 Similar to Starch synthase isoform zSTSII-2 (EC 2.4.1.21).
TTCACCTCCTCTTCGCCGCGGCGCAGGCGGAGCAGGGTGAGCGGGGTTTGGTGGCACTTG
TATGGTGGCACGGGGCTGCGGTTGCATTGGGAGCGGCGGGGTTTGGTTCGGGACGGAGCC
GTCGTGTGCTCGGCGTCGGCCGCCGGTGGTGAGGATGGCGTCGCGAAGGCGAAGACGAAG
TCAGCGGGGAGCTCGAAGGCGGTCGCTGTGCAGGGCAGCACGGCCAAGGCTGATCATGTT
GAGGATTCAGTTTCATCACCCAAATACGTGAAACCTGCCGTTGCGAAGCAAAATGGAGAG
GTTGTGAGCAGAGCTACCAAATCTGATGCACCAGTGTCTAAACCCAAAGTTGACCCGTCA
GTTCCTGCTTCCAAGGCTGAAGCTGATGGTAATGCACAAGCTGTGGAATCGAAGGCTGCA
CTGGACAAGAAGGAAGACGTCGGTGTTGCTGAACCGTTGGAAGCTAAGGCTGATGCTGGT
GGAGATGCAGGTGCAGTAAGCTCTGCAGATGATAGTGAGAACAAGGAATCTGGTCCATTG
GCAGGGCCAAATGTGATGAATGTCATTGTGGTGGCTTCTGAATGTTCTCCTTTCTGTAAA
ACAGGTGGTCTTGGAGATGTTGTGGGTGCTTTGCCTAAGGCTCTGGCAAGAAGAGGACAT
CGTGTTATGGTTGTGATACCAAGATACGGAGAATATGCAGAAGCCAAGGATCTAGGTGTC
CGCAAACGTTACAGGGTAGCTGGACAGGATTCAGAAGTGAGTTATTTTCATGCTTTTATC
GATGGTGTTGATTTTGTGTTTCTAGAGGCCCCTCCCTTTCGACACCGGCACAATGATATT
TATGGAGGAGAAAGATTTGATGTTTTGAAGCGTATGATTTTGTTCTGCAAAGCTGCTGTT
GAGGTTCCTTGGTTTGCTCCATGTGGTGGTTCCATCTACGGTGATGGCAATTTAGTCTTC
ATTGCAAATGATTGGCATACTGCACTTTTACCCGTATATTTGAAGGCATATTACCGAGAT
AATGGCTTGATGCAGTATACTCGCTCTGTTCTTGTGATACACAACATTGCTCATCAGGGT
CGTGGCCCTGTAGATGACTTCGCCACGATGGACTTGCCCGAGCACTACATCGATCATTTC
AGACTGTACGACCCCGTCGGCGGTGAGCACAGCAACGTGTTCGCCGCTGGCCTGAAGATG
GCTGACCGCGCGGTCACCGTCAGCCATGGCTATCTGTGGGAGATCAAGACAATGGACGGT
GGCTGGGGCCTCCACGAGATAATAAACCACAACGACTGGAAGCTGCAGGGCATCGTGAAC
GGCATCGACATGGCCGAATGGAACCCCGAGGTGGACGAGCACCTGCAGTCCGACGGCTAC
GCCAACTACACGTTCGAGACGCTGGACACCGGCAAGAAACAGTGCAAGGAGGCGCTGCAG
CGGCAGCTGGGCCTGCAGGTCCGCGACGACGTGCCGCTGATCGGGTTCATCGGGCGGCTC
GACCACCAGAAGGGCGTGGACATCAtcggcgacgcgatgccgtggatcgccgggcaggac
gtgcaggtggtgatgctgggcacggggcggccggacctggaggagatgctgcggcggttc
gagtcgGAGCACAACGACAAGGTGCGCGGGTGGGTGGGGTTCTCGGTGCAGCTGGCGCAC
CGGATCACGGCGGGCGCCGACGTCCTCCTGATGCCGTCGCGGTTCGAGCCGTGCGGGCTG
AACCAGCTGTACGCCATGGCGTACGGCACCGTGCCCGTGGTGCACGCCGTGGGCGGGCTC
CGCGACACGGTGGCGCCGTTCGACCCGTTCGCCGACACGGGGCTCGGGTGGACGTTCGAC
CGCGCCGAGGCGAACCGGATGATCGACGCGCTCGGGCACTGCCTCAACACGTACCGGAAC
TACAAGGAGAGCTGGAGGGGGCTCCAGGCGCGCGGCATGGCGCAGGACCTCAGCTGGGAC
CACGCCGCCGAGCTCTACGAGGACGTCCTCGTCAAGGCCAAGTACCAGTGGTGA

Protein

678 aa

>Os02t0744700-01 Similar to Starch synthase isoform zSTSII-2 (EC 2.4.1.21).
FTSSSPRRRRSRVSGVWWHLYGGTGLRLHWERRGLVRDGAVVCSASAAGGEDGVAKAKTK
SAGSSKAVAVQGSTAKADHVEDSVSSPKYVKPAVAKQNGEVVSRATKSDAPVSKPKVDPS
VPASKAEADGNAQAVESKAALDKKEDVGVAEPLEAKADAGGDAGAVSSADDSENKESGPL
AGPNVMNVIVVASECSPFCKTGGLGDVVGALPKALARRGHRVMVVIPRYGEYAEAKDLGV
RKRYRVAGQDSEVSYFHAFIDGVDFVFLEAPPFRHRHNDIYGGERFDVLKRMILFCKAAV
EVPWFAPCGGSIYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMQYTRSVLVIHNIAHQG
RGPVDDFATMDLPEHYIDHFRLYDPVGGEHSNVFAAGLKMADRAVTVSHGYLWEIKTMDG
GWGLHEIINHNDWKLQGIVNGIDMAEWNPEVDEHLQSDGYANYTFETLDTGKKQCKEALQ
RQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDVQVVMLGTGRPDLEEMLRRF
ESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLNQLYAMAYGTVPVVHAVGGL
RDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNYKESWRGLQARGMAQDLSWD
HAAELYEDVLVKAKYQW*

5'UTR

chr02:31238026..31238210 (- strand) : 185 bp

CDS

chr02:31238018..31238025 (- strand) : 8 bp

chr02:31237642..31237861 (- strand) : 220 bp

chr02:31236865..31237240 (- strand) : 376 bp

chr02:31236677..31236741 (- strand) : 65 bp

chr02:31236176..31236253 (- strand) : 78 bp

chr02:31235970..31236080 (- strand) : 111 bp

chr02:31235827..31235871 (- strand) : 45 bp

chr02:31235174..31235347 (- strand) : 174 bp

chr02:31233717..31234673 (- strand) : 957 bp

3'UTR

chr02:31233292..31233716 (- strand) : 425 bp

FASTA

>Os02t0744700-01 class=Sequence position=chr02:31233292..31238210 (- strand)
AATCTCTTTT CTCTCGTCGT CGTCTCGTCT TCCCACCTCT CGGATTCCCG AGCTCCACAC GACACGACCC ACCTCGGCCA
CTCTCCGCCG TCGGTGGCCA GTGGCCTCCA CCCCCTCCGT CCCCCGGGGA CCACACCGGC GTAACATCAG CCACACCTCC
GGCAGATCTT TCCCCCGCCG CTTAATTCAC CTCGTGCGCG CGCGGCGCCG CTCGTTGCCT AGCTAGCTAG CTCGGCCGCA
ATCTAGTAGT AGTAGTAGGA GGAGGAGGAG CGGCGGCGGC GGCGGATCCT ATGTCGGGGG CAATCGCTTC CTCGCCGGCG
GCTACTCTCT TCCTCGCTGG CTCCTCCTCC TCTTCGCCGC GGCGCAGGCG GAGCAGGGTG AGCGGGGTTT GGTGGCACTT
GTATGGTGGC ACGGGGCTGC GGTTGCATTG GGAGCGGCGG GGTTTGGTTC GGGACGGAGC CGTCGTGTGC TCGGCGTCGG
CCGCCGGTGG TGAGGATGGC GTCGCGAAGG CGAAGACGAA GTCAGCGGGG AGCTCGAAGG CGGTCGCTGT GCAGGGCAGC
ACGGCCAAGG TTGATACTTT TCCTCCATTT TTTTTAGAAC CAAGCTTGAG ACTGTTGGCC CACGTGTTTC AGACTTTCAG
ATCGTGTCAT TTTGATATTT TAACTACTTT TCGTGATTTG ATTATAGTAT GCGTGCCAGA ACGTGCAATT AGTTAGTGCA
AATAGCGCAG TTACATGTAG AGCCATGTTG CTAGAACTAC AGTTGCTTGA TCTAGCGAGC TAGGAGCTAA TTATTTACCA
TTTGTTATTC GGAAATGTTA CCTCGCTGCA CTTTTTGACA TGAATTTCCC TATCCAACTT GTTTAGTATA TTCCACTACC
CCTGTGTGAC ATTTCATTTT TCAAGTTGAT AATGCTTAAA TGCTTATAAC TTTGCTGATT CTGGTTGAGT GATGGTGTAT
ATGCATTCAG GCTGATCATG TTGAGGATTC AGTTTCATCA CCCAAATACG TGAAACCTGC CGTTGCGAAG CAAAATGGAG
AGGTTGTGAG CAGAGCTACC AAATCTGATG CACCAGTGTC TAAACCCAAA GTTGACCCGT CAGTTCCTGC TTCCAAGGCT
GAAGCTGATG GTAATGCACA AGCTGTGGAA TCGAAGGCTG CACTGGACAA GAAGGAAGAC GTCGGTGTTG CTGAACCGTT
GGAAGCTAAG GCTGATGCTG GTGGAGATGC AGGTGCAGTA AGCTCTGCAG ATGATAGTGA GAACAAGGAA TCTGGTCCAT
TGGCAGGGCC AAATGTGATG AATGTCATTG TGGTGGCTTC TGAATGTTCT CCTTTCTGTA AAACAGGTAT GCATATCTAA
ACTGGAAATT GGGCCTGACC CCATCATTTC CCCTTTTTGA GCATGACCAA TCAGGCTTTT ACTTTTAAGC TTAGGCAATG
TTCCTTCTAA TAACTGCTAT CATGTGAAGG TGGTCTTGGA GATGTTGTGG GTGCTTTGCC TAAGGCTCTG GCAAGAAGAG
GACATCGTGT TATGGTACGT ACTCCTTCAC ATTTGTCTTT GTTTGATTGT CTCGGAAGAG ATTAACAATC TGTAGTACTA
GTATATGTGC AATCCACAAC GTAAGAGACT AAGAGGTGGT ATTTTGATTG TTATATCTGA AACTCTTAAG TCTCATTCTT
TTGATTTGCG TGCATCATGG AAAACAATCC TCAAATTGTT ACCCTGTTGT CTCTGTCAGC TATTAAATGT TGTTTCACAT
ATTTAGGAGA GAAGTGTGGA AATCTATCTT GTATTCTTGT TAGATAACAA TTTTTGAGCT GTATGATTTA GCATGCTTGA
GATGGATGAC AATTCTTAAG ATAGCATCTT AAATTGAAAT GTAGTAGGAT ATGCACCGAT TGAGTTCAGT GGCTTAGTTT
TAAGTGATCC AAATATAAGT GGCTATTTCA ATTTTAGGTT GTGATACCAA GATACGGAGA ATATGCAGAA GCCAAGGATC
TAGGTGTCCG CAAACGTTAC AGGGTAGCTG GACAGGTAAG AAAACATTGA AACAGTTATT GTGCAATGTG AAATGAAAAG
TTTAAAGGTT CATGATAGAA TCTTTTTTTT TCTGTGTGTG TGGTTTTCAG GATTCAGAAG TGAGTTATTT TCATGCTTTT
ATCGATGGTG TTGATTTTGT GTTTCTAGAG GCCCCTCCCT TTCGACACCG GCACAATGAT ATTTATGGAG GAGAAAGATT
TGTAAGTCCC AATTTTTCTA TAGCTTAATT GACTTACAAA TAAGTTCCTT TTAAATCTTC TGTAAATATT TTTTGCACAA
TTTTATCATT TGATGGCAGG ATGTTTTGAA GCGTATGATT TTGTTCTGCA AAGCTGCTGT TGAGGTAACT TCCCATTTTA
TTGCTACTAG TCTATAAATG TACTCCTTAC AGTTCTGTTA GATTCGCAGC TCACTCCACC ACGAGTGGGC CACCCAGGTC
TCACCACCAT CAATTTCCAG TGGGACTAAA CACAATAATT TCTTACTACA GTCCACAATT AGAATTTCGT ACACCAGCTG
GTCAGTCGAT GCATATCCAA GTTTCTTGCA GCAAGCTGTT TATGCACCTT TCACTACTTC GTAGCAAACA GTTAATACTA
AAATTTTGAT GTTTGACAAT TAGAATTTAG TACACCATCT AGTCAGTCGA TATATATCTG AGTGTCTTGC AGCAAGCTGT
TTGTGTGCCA TTGACTACTT TGTAGAAAAC ACAAGAACAA TTAATGATAA GATTTTCATG TTTGTTTTAG TTTATGAGGT
GAATGAGCCT GATGTTATGT TCTCGAATAA GTACAATTCA TTCATCTGAT GAAACATTTG CAGGTTCCTT GGTTTGCTCC
ATGTGGTGGT TCCATCTACG GTGATGGCAA TTTAGTCTTC ATTGCAAATG ATTGGCATAC TGCACTTTTA CCCGTATATT
TGAAGGCATA TTACCGAGAT AATGGCTTGA TGCAGTATAC TCGCTCTGTT CTTGTGATAC ACAACATTGC TCATCAGGTT
TTTCACCTAG TCTTATTCTG CAATTTCATT CTTCGAATAT TATCTGAACC ACTAATGTAC TTGTTTTCAA GTGATCTGCT
CAATGGCATT TGTATTTTGC AAGTGTTTCT CCTTTTCTTT AATAAGGGCC ATACAATTTT AAACCTGGTA TTCAGATAAA
GTACAAAATT CAGTTCAGAG TTGTGTACTG GAATACAGCA GAGTGCACCT GCTATTTTAC CCTATATGTA GAAAATATAG
GAAATTTGTG TTTATTTATG ACACCAGTTT TGTTCTTACG AAGTTGAATT AGTTATTGAT TTTGCCTCTT GAAAGATAAT
TGACTATACT ACTGTCATAG TGACACCAAT TTAGTTCTAA TGAAAGTTAA ATTGGCTTCT ATTTATTTTA TGATTGCGTT
TCGCAATGTA ATTCAATCTT GTTTTCCCGC TTGTCATCCG TGGGCATTTA CCTTGATGCT AATCTCTTAT AGATGTTTCA
TGATTTTCTT CTTTCAGGGT CGTGGCCCTG TAGATGACTT CGCCACGATG GACTTGCCCG AGCACTACAT CGATCATTTC
AGACTGTACG ACCCCGTCGG CGGTGAGCAC AGCAACGTGT TCGCCGCTGG CCTGAAGATG GCTGACCGCG CGGTCACCGT
CAGCCATGGC TATCTGTGGG AGATCAAGAC AATGGACGGT GGCTGGGGCC TCCACGAGAT AATAAACCAC AACGACTGGA
AGCTGCAGGG CATCGTGAAC GGCATCGACA TGGCCGAATG GAACCCCGAG GTGGACGAGC ACCTGCAGTC CGACGGCTAC
GCCAACTACA CGTTCGAGAC GCTGGACACC GGCAAGAAAC AGTGCAAGGA GGCGCTGCAG CGGCAGCTGG GCCTGCAGGT
CCGCGACGAC GTGCCGCTGA TCGGGTTCAT CGGGCGGCTC GACCACCAGA AGGGCGTGGA CATCAtcggc gacgcgatgc
cgtggatcgc cgggcaggac gtgcaggtgg tgatgctggg cacggggcgg ccggacctgg aggagatgct gcggcggttc
gagtcgGAGC ACAACGACAA GGTGCGCGGG TGGGTGGGGT TCTCGGTGCA GCTGGCGCAC CGGATCACGG CGGGCGCCGA
CGTCCTCCTG ATGCCGTCGC GGTTCGAGCC GTGCGGGCTG AACCAGCTGT ACGCCATGGC GTACGGCACC GTGCCCGTGG
TGCACGCCGT GGGCGGGCTC CGCGACACGG TGGCGCCGTT CGACCCGTTC GCCGACACGG GGCTCGGGTG GACGTTCGAC
CGCGCCGAGG CGAACCGGAT GATCGACGCG CTCGGGCACT GCCTCAACAC GTACCGGAAC TACAAGGAGA GCTGGAGGGG
GCTCCAGGCG CGCGGCATGG CGCAGGACCT CAGCTGGGAC CACGCCGCCG AGCTCTACGA GGACGTCCTC GTCAAGGCCA
AGTACCAGTG GTGAGCTGGT GGTATTTTTC GCGACGCCTC TGGATCCCGC CGTGGATGGG CGCGCTTTTT CTCTAGGGCG
GCTCTGCGTC GGAGACGCTC AGACGCATCG CGCGCGTTCG CGCCCACACG ATGACTGGCA CGCTGCTGCT GAGACGGCGG
CACGCGATGC CATCATGCCA CCGGACGGTA GGAGCAACGG TGGAAGTGAA CTGTACTACT GGTGCTACAC TGCTACTACA
TGAGATCTGC TCTTATTGGT CACGTACTCA CGTTCACGCT GAATTACCGA ATGTGTTGTG TCTTGTGTGT GTGTGTTAAA
GGCATTGTCC TGGTAAATGG TGGAGACGAG ATGGCCGGGT CGCGGGAGTT ATATTTGTAT ATGTTGCCAG CTTTCTGAGT
TTTTCAAGCC AGTGCGGCTC TTCAGTGCAG GTTCCAAGC

Locus: Os02g0744700

Loading...

Locus: Os02g0744700

Loading...