Os02t0744700-02

Locus

Os02g0744700

Description

Similar to Soluble starch synthase 2-2, chloroplastic/amyloplastic.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SSIIB

CGSNL Gene Name

SOLUBLE STARCH SYNTHASE IIB

Oryzabase Gene Symbol Synonym(s)

OsSSIIb, OsSSII-2, SSII-2, SS2, OsSSSIIb, SS2b

Oryzabase Gene Name Synonym(s)

Starch synthase-IIb, starch synthase IIb, "Soluble starch synthase 2-2, chloroplastic/amyloplastic", Soluble starch synthase II-2, Starch synthase isoform zSTSII-2

Transcript Evidence

AK061803 (DDBJ, Best hit)

Protein Evidence

D0TZP8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: glucan biosynthetic process (GO:0009250)

Molecular Function: starch synthase activity (GO:0009011)

Functional domain (InterPro)

Glycosyl transferase, family 1 (IPR001296)

Glycogen/starch synthases, ADP-glucose type (IPR011835)

Starch synthase, catalytic domain (IPR013534)

Full-length cDNA

001-039-H12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0744700-02)

RiceXPro (AK061803)

Others

Oryzabase (8103)

KEGG (Os02t0744700-02 (EC:2.4.1.183))

Transcript

1609 bp

>Os02t0744700-02 Similar to Soluble starch synthase 2-2, chloroplastic/amyloplastic.
TTTTGTGTTTCTAGAGGCCCCTCCCTTTCGACACCGGCACAATGATATTTATGGAGGAGA
AAGATTTGATGTTTTGAAGCGTATGATTTTGTTCTGCAAAGCTGCTGTTGAGGTTCCTTG
GTTTGCTCCATGTGGTGGTTCCATCTACGGTGATGGCAATTTAGTCTTCATTGCAAATGA
TTGGCATACTGCACTTTTACCCGTATATTTGAAGGCATATTACCGAGATAATGGCTTGAT
GCAGTATACTCGCTCTGTTCTTGTGATACACAACATTGCTCATCAGGGTCGTGGCCCTGT
AGATGACTTCGCCACGATGGACTTGCCCGAGCACTACATCGATCATTTCAGACTGTACGA
CCCCGTCGGCGGTGAGCACAGCAACGTGTTCGCCGCTGGCCTGAAGATGGCTGACCGCGC
GGTCACCGTCAGCCATGGCTATCTGTGGGAGATCAAGACAATGGACGGTGGCTGGGGCCT
CCACGAGATAATAAACCACAACGACTGGAAGCTGCAGGGCATCGTGAACGGCATCGACAT
GGCCGAATGGAACCCCGAGGTGGACGAGCACCTGCAGTCCGACGGCTACGCCAACTACAC
GTTCGAGACGCTGGACACCGGCAAGAAACAGTGCAAGGAGGCGCTGCAGCGGCAGCTGGG
CCTGCAGGTCCGCGACGACGTGCCGCTGATCGGGTTCATCGGGCGGCTCGACCACCAGAA
GGGCGTGGACATCAtcggcgacgcgatgccgtggatcgccgggcaggacgtgcaggtggt
gatgctgggcacggggcggccggacctggaggagatgctgcggcggttcgagtcgGAGCA
CAACGACAAGGTGCGCGGGTGGGTGGGGTTCTCGGTGCAGCTGGCGCACCGGATCACGGC
GGGCGCCGACGTCCTCCTGATGCCGTCGCGGTTCGAGCCGTGCGGGCTGAACCAGCTGTA
CGCCATGGCGTACGGCACCGTGCCCGTGGTGCACGCCGTGGGCGGGCTCCGCGACACGGT
GGCGCCGTTCGACCCGTTCGCCGACACGGGGCTCGGGTGGACGTTCGACCGCGCCGAGGC
GAACCGGATGATCGACGCGCTCGGGCACTGCCTCAACACGTACCGGAACTACAAGGAGAG
CTGGAGGGGGCTCCAGGCGCGCGGCATGGCGCAGGACCTCAGCTGGGACCACGCCGCCGA
GCTCTACGAGGACGTCCTCGTCAAGGCCAAGTACCAGTGGTGAGCTGGTGGTATTTTTCG
CGACGCCTCTGGATCCCGCCGTGGATGGGCGCGCTTTTTCTCTAGGGCGGCTCTGCGTCG
GAGACGCTCAGACGCATCGCGCGCGTTCGCGCCCACACGATGACTGGCACGCTGCTGCTG
AGACGGCGGCACGCGATGCCATCATGCCACCGGACGGTAGGAGCAACGGTGGAAGTGAAC
TGTACTACTGGTGCTACACTGCTACTACATGAGATCTGCTCTTATTGGTCACGTACTCAC
GTTCACGCTGAATTACCGAATGTGTTGTGTCTTGTGTGTGTGTGTTAAAGGCATTGTCCT
GGTAAATGGTGGAGACGAGATGGCCGGGTCGCGGGAGTTATATTTGTAT

CDS

1242 bp

>Os02t0744700-02 Similar to Soluble starch synthase 2-2, chloroplastic/amyloplastic.
TTTGTGTTTCTAGAGGCCCCTCCCTTTCGACACCGGCACAATGATATTTATGGAGGAGAA
AGATTTGATGTTTTGAAGCGTATGATTTTGTTCTGCAAAGCTGCTGTTGAGGTTCCTTGG
TTTGCTCCATGTGGTGGTTCCATCTACGGTGATGGCAATTTAGTCTTCATTGCAAATGAT
TGGCATACTGCACTTTTACCCGTATATTTGAAGGCATATTACCGAGATAATGGCTTGATG
CAGTATACTCGCTCTGTTCTTGTGATACACAACATTGCTCATCAGGGTCGTGGCCCTGTA
GATGACTTCGCCACGATGGACTTGCCCGAGCACTACATCGATCATTTCAGACTGTACGAC
CCCGTCGGCGGTGAGCACAGCAACGTGTTCGCCGCTGGCCTGAAGATGGCTGACCGCGCG
GTCACCGTCAGCCATGGCTATCTGTGGGAGATCAAGACAATGGACGGTGGCTGGGGCCTC
CACGAGATAATAAACCACAACGACTGGAAGCTGCAGGGCATCGTGAACGGCATCGACATG
GCCGAATGGAACCCCGAGGTGGACGAGCACCTGCAGTCCGACGGCTACGCCAACTACACG
TTCGAGACGCTGGACACCGGCAAGAAACAGTGCAAGGAGGCGCTGCAGCGGCAGCTGGGC
CTGCAGGTCCGCGACGACGTGCCGCTGATCGGGTTCATCGGGCGGCTCGACCACCAGAAG
GGCGTGGACATCAtcggcgacgcgatgccgtggatcgccgggcaggacgtgcaggtggtg
atgctgggcacggggcggccggacctggaggagatgctgcggcggttcgagtcgGAGCAC
AACGACAAGGTGCGCGGGTGGGTGGGGTTCTCGGTGCAGCTGGCGCACCGGATCACGGCG
GGCGCCGACGTCCTCCTGATGCCGTCGCGGTTCGAGCCGTGCGGGCTGAACCAGCTGTAC
GCCATGGCGTACGGCACCGTGCCCGTGGTGCACGCCGTGGGCGGGCTCCGCGACACGGTG
GCGCCGTTCGACCCGTTCGCCGACACGGGGCTCGGGTGGACGTTCGACCGCGCCGAGGCG
AACCGGATGATCGACGCGCTCGGGCACTGCCTCAACACGTACCGGAACTACAAGGAGAGC
TGGAGGGGGCTCCAGGCGCGCGGCATGGCGCAGGACCTCAGCTGGGACCACGCCGCCGAG
CTCTACGAGGACGTCCTCGTCAAGGCCAAGTACCAGTGGTGA

Protein

414 aa

>Os02t0744700-02 Similar to Soluble starch synthase 2-2, chloroplastic/amyloplastic.
FVFLEAPPFRHRHNDIYGGERFDVLKRMILFCKAAVEVPWFAPCGGSIYGDGNLVFIAND
WHTALLPVYLKAYYRDNGLMQYTRSVLVIHNIAHQGRGPVDDFATMDLPEHYIDHFRLYD
PVGGEHSNVFAAGLKMADRAVTVSHGYLWEIKTMDGGWGLHEIINHNDWKLQGIVNGIDM
AEWNPEVDEHLQSDGYANYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQK
GVDIIGDAMPWIAGQDVQVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITA
GADVLLMPSRFEPCGLNQLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEA
NRMIDALGHCLNTYRNYKESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW*

5'UTR

chr02:31236036..31236036 (- strand) : 1 bp

CDS

chr02:31235970..31236035 (- strand) : 66 bp

chr02:31235827..31235871 (- strand) : 45 bp

chr02:31235174..31235347 (- strand) : 174 bp

chr02:31233717..31234673 (- strand) : 957 bp

3'UTR

chr02:31233351..31233716 (- strand) : 366 bp

FASTA

>Os02t0744700-02 class=Sequence position=chr02:31233351..31236036 (- strand)
TTTTGTGTTT CTAGAGGCCC CTCCCTTTCG ACACCGGCAC AATGATATTT ATGGAGGAGA AAGATTTGTA AGTCCCAATT
TTTCTATAGC TTAATTGACT TACAAATAAG TTCCTTTTAA ATCTTCTGTA AATATTTTTT GCACAATTTT ATCATTTGAT
GGCAGGATGT TTTGAAGCGT ATGATTTTGT TCTGCAAAGC TGCTGTTGAG GTAACTTCCC ATTTTATTGC TACTAGTCTA
TAAATGTACT CCTTACAGTT CTGTTAGATT CGCAGCTCAC TCCACCACGA GTGGGCCACC CAGGTCTCAC CACCATCAAT
TTCCAGTGGG ACTAAACACA ATAATTTCTT ACTACAGTCC ACAATTAGAA TTTCGTACAC CAGCTGGTCA GTCGATGCAT
ATCCAAGTTT CTTGCAGCAA GCTGTTTATG CACCTTTCAC TACTTCGTAG CAAACAGTTA ATACTAAAAT TTTGATGTTT
GACAATTAGA ATTTAGTACA CCATCTAGTC AGTCGATATA TATCTGAGTG TCTTGCAGCA AGCTGTTTGT GTGCCATTGA
CTACTTTGTA GAAAACACAA GAACAATTAA TGATAAGATT TTCATGTTTG TTTTAGTTTA TGAGGTGAAT GAGCCTGATG
TTATGTTCTC GAATAAGTAC AATTCATTCA TCTGATGAAA CATTTGCAGG TTCCTTGGTT TGCTCCATGT GGTGGTTCCA
TCTACGGTGA TGGCAATTTA GTCTTCATTG CAAATGATTG GCATACTGCA CTTTTACCCG TATATTTGAA GGCATATTAC
CGAGATAATG GCTTGATGCA GTATACTCGC TCTGTTCTTG TGATACACAA CATTGCTCAT CAGGTTTTTC ACCTAGTCTT
ATTCTGCAAT TTCATTCTTC GAATATTATC TGAACCACTA ATGTACTTGT TTTCAAGTGA TCTGCTCAAT GGCATTTGTA
TTTTGCAAGT GTTTCTCCTT TTCTTTAATA AGGGCCATAC AATTTTAAAC CTGGTATTCA GATAAAGTAC AAAATTCAGT
TCAGAGTTGT GTACTGGAAT ACAGCAGAGT GCACCTGCTA TTTTACCCTA TATGTAGAAA ATATAGGAAA TTTGTGTTTA
TTTATGACAC CAGTTTTGTT CTTACGAAGT TGAATTAGTT ATTGATTTTG CCTCTTGAAA GATAATTGAC TATACTACTG
TCATAGTGAC ACCAATTTAG TTCTAATGAA AGTTAAATTG GCTTCTATTT ATTTTATGAT TGCGTTTCGC AATGTAATTC
AATCTTGTTT TCCCGCTTGT CATCCGTGGG CATTTACCTT GATGCTAATC TCTTATAGAT GTTTCATGAT TTTCTTCTTT
CAGGGTCGTG GCCCTGTAGA TGACTTCGCC ACGATGGACT TGCCCGAGCA CTACATCGAT CATTTCAGAC TGTACGACCC
CGTCGGCGGT GAGCACAGCA ACGTGTTCGC CGCTGGCCTG AAGATGGCTG ACCGCGCGGT CACCGTCAGC CATGGCTATC
TGTGGGAGAT CAAGACAATG GACGGTGGCT GGGGCCTCCA CGAGATAATA AACCACAACG ACTGGAAGCT GCAGGGCATC
GTGAACGGCA TCGACATGGC CGAATGGAAC CCCGAGGTGG ACGAGCACCT GCAGTCCGAC GGCTACGCCA ACTACACGTT
CGAGACGCTG GACACCGGCA AGAAACAGTG CAAGGAGGCG CTGCAGCGGC AGCTGGGCCT GCAGGTCCGC GACGACGTGC
CGCTGATCGG GTTCATCGGG CGGCTCGACC ACCAGAAGGG CGTGGACATC Atcggcgacg cgatgccgtg gatcgccggg
caggacgtgc aggtggtgat gctgggcacg gggcggccgg acctggagga gatgctgcgg cggttcgagt cgGAGCACAA
CGACAAGGTG CGCGGGTGGG TGGGGTTCTC GGTGCAGCTG GCGCACCGGA TCACGGCGGG CGCCGACGTC CTCCTGATGC
CGTCGCGGTT CGAGCCGTGC GGGCTGAACC AGCTGTACGC CATGGCGTAC GGCACCGTGC CCGTGGTGCA CGCCGTGGGC
GGGCTCCGCG ACACGGTGGC GCCGTTCGAC CCGTTCGCCG ACACGGGGCT CGGGTGGACG TTCGACCGCG CCGAGGCGAA
CCGGATGATC GACGCGCTCG GGCACTGCCT CAACACGTAC CGGAACTACA AGGAGAGCTG GAGGGGGCTC CAGGCGCGCG
GCATGGCGCA GGACCTCAGC TGGGACCACG CCGCCGAGCT CTACGAGGAC GTCCTCGTCA AGGCCAAGTA CCAGTGGTGA
GCTGGTGGTA TTTTTCGCGA CGCCTCTGGA TCCCGCCGTG GATGGGCGCG CTTTTTCTCT AGGGCGGCTC TGCGTCGGAG
ACGCTCAGAC GCATCGCGCG CGTTCGCGCC CACACGATGA CTGGCACGCT GCTGCTGAGA CGGCGGCACG CGATGCCATC
ATGCCACCGG ACGGTAGGAG CAACGGTGGA AGTGAACTGT ACTACTGGTG CTACACTGCT ACTACATGAG ATCTGCTCTT
ATTGGTCACG TACTCACGTT CACGCTGAAT TACCGAATGT GTTGTGTCTT GTGTGTGTGT GTTAAAGGCA TTGTCCTGGT
AAATGGTGGA GACGAGATGG CCGGGTCGCG GGAGTTATAT TTGTAT

Locus: Os02g0744700

Loading...

Locus: Os02g0744700

Loading...