Os02t0747900-01

Locus

Os02g0747900

Description

Atypical basic helix-loop-helix protein, Control of cell elongation, Regulator of grain size and leaf angle

RAP-DB Gene Symbol Synonym(s)

ILI5, OsBUL1, PGL2

RAP-DB Gene Name Synonym(s)

INCREASED LEAF INCLINATION 5, Increased Leaf Inclination 5, BRASSINOSTEROID UPREGULATED 1-LIKE1, POSITIVE REGULATOR OF GRAIN LENGTH 2

CGSNL Gene Symbol

ILI5

CGSNL Gene Name

INCREASED LEAF INCLINATION 5

Oryzabase Gene Symbol Synonym(s)

ILI5, OsILI5, PGL2, OsPGL2, Os170, OsBUL1, BUL1, ILI5/PGL2, OsbHLH170, bHLH170

Oryzabase Gene Name Synonym(s)

Increased Leaf Inclination 5, POSITIVE REGULATOR OF GRAIN LENGTH 2, BRASSINOSTEROID UPREGULATED 1-LIKE1, BRASSINOSTEROID UPREGULATED1 LIKE1, basic helix-loop-helix protein 170

Transcript Evidence

Inferred

Protein Evidence

Q6YUX0

Literature

PMID: 27879391

PMID: 23136524

Note

Manual Curation

January 5, 2017

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Expression Databases

TENOR (Os02t0747900-00)

Others

Oryzabase (10948)

Transcript

1071 bp

>Os02t0747900-01 Atypical basic helix-loop-helix protein, Control of cell elongation, Regulator of grain size and leaf angle
CACACACACTTCTCCCATCCAGCTAGCTTTTGCAGATCGAGCGAACCTTCAACACAAACC
GGCCAGCTTGTTCCTCTCCTCTCTCTCTCTCTCTCTCTCTCTCTCGGTCGCAGCCAGCTA
ACTTCGAGTGTGAAGAACACTCACGCTAGCTAGCTTTCTCAAGGCCACATACGCTAGCTC
CGCCTCCACGCGCGGCGTACGTCTAGTTTGATTGAGGCTGAAGAGAGTGCGTGTTTGGTA
GAAGAGGCTAGCTGTTGACGATGTCGAGCAGAAGGTCGTCGCGTGGCTCCATCTCGGAGG
AGGAAATCAACGAGCTCATCTCCAAGCTCCAGTCGCTGCTCCCCAACTCACGCCGACGCG
GCTCCAGCCAGGCGTCGACGACGAAGCTGCTGAAGGAGACGTGCAACTACATCAAGAGCC
TTCACCGGGAGGTGGATGACCTCAGCGACCGGCTGTCCGACCTCATGGCCACCATGGATC
ACAACAGCCCCGGCGCGGAGATCATCCGCAGCATCCTCCGCTCCTGATCGGCAAGCAGCA
GCAGCAAGCGGCACCGGCCGGCCGGCCGGCCTATGTCGACGACGAGATAGGCCGGGCCGG
CCGGGCAACGCCCGCGGCGCCAATTAATCAAGCGTACGTCCTGCCGGCGCCATTCTCCGG
CCACCAGAGAGCATTTAGCTAGGGTATATATATCTACATATATAAAATATTTATGTCGTA
TGTCCCTCCCCAAATGTACGAGCCACGCTTACACGCGCGTGTATCGATCTCTCGATCTCT
CTCTCTAAGCTCCACTCGAAGTAGGGCATTAGCACTAGGGGCCTAAGCAGAGGCTTATCC
TCGCTTTAGCTCATATTTTCATCGCTTGATGTGTCCTCTCTGAACCCCCACATCTTGTCT
TGTTTGGTTTTTCCCTCTCCCTTCCAATCTATGTAAATTTAGCTGGTGTGGTTTGGATCG
AGTTGTGTCCTCTACAGACAACCGACCGACCACTACTACCTAGAGGAAATTAATATCATC
ATGGGTGTACTGCTCCAGCTTTAACTTCAATTCAGTTGGCTACGTACTACG

CDS

267 bp

>Os02t0747900-01 Atypical basic helix-loop-helix protein, Control of cell elongation, Regulator of grain size and leaf angle
ATGTCGAGCAGAAGGTCGTCGCGTGGCTCCATCTCGGAGGAGGAAATCAACGAGCTCATC
TCCAAGCTCCAGTCGCTGCTCCCCAACTCACGCCGACGCGGCTCCAGCCAGGCGTCGACG
ACGAAGCTGCTGAAGGAGACGTGCAACTACATCAAGAGCCTTCACCGGGAGGTGGATGAC
CTCAGCGACCGGCTGTCCGACCTCATGGCCACCATGGATCACAACAGCCCCGGCGCGGAG
ATCATCCGCAGCATCCTCCGCTCCTGA

Protein

89 aa

>Os02t0747900-01 Atypical basic helix-loop-helix protein, Control of cell elongation, Regulator of grain size and leaf angle
MSSRRSSRGSISEEEINELISKLQSLLPNSRRRGSSQASTTKLLKETCNYIKSLHREVDD
LSDRLSDLMATMDHNSPGAEIIRSILRS*

5'UTR

chr02:31424980..31425239 (- strand) : 260 bp

CDS

chr02:31424869..31424979 (- strand) : 111 bp

chr02:31424487..31424642 (- strand) : 156 bp

3'UTR

chr02:31423943..31424486 (- strand) : 544 bp

FASTA

>Os02t0747900-01 class=Sequence position=chr02:31423943..31425239 (- strand)
CACACACACT TCTCCCATCC AGCTAGCTTT TGCAGATCGA GCGAACCTTC AACACAAACC GGCCAGCTTG TTCCTCTCCT
CTCTCTCTCT CTCTCTCTCT CTCTCGGTCG CAGCCAGCTA ACTTCGAGTG TGAAGAACAC TCACGCTAGC TAGCTTTCTC
AAGGCCACAT ACGCTAGCTC CGCCTCCACG CGCGGCGTAC GTCTAGTTTG ATTGAGGCTG AAGAGAGTGC GTGTTTGGTA
GAAGAGGCTA GCTGTTGACG ATGTCGAGCA GAAGGTCGTC GCGTGGCTCC ATCTCGGAGG AGGAAATCAA CGAGCTCATC
TCCAAGCTCC AGTCGCTGCT CCCCAACTCA CGCCGACGCG GCTCCAGCCA GGTAGCTAAC CACATTCTTG CATACGCCAA
CTGCTTGTGT ACTGCTAGTG TGCTGCCACT TTGGTAGTAG CTATAGGTTT GCTTTCGGTG AACACAGAAG TGGCTACTAC
TAGAACAATC CACACACTAC TATAGTCGTG TGTGTGGGTG GTGGTTTGGG GTTAAGCCCG TGAGCGATTC GGTGTGTGTT
TTGTCTGCAC GAGACGAGTA ATGTGGCGTT AATGCAGGCG TCGACGACGA AGCTGCTGAA GGAGACGTGC AACTACATCA
AGAGCCTTCA CCGGGAGGTG GATGACCTCA GCGACCGGCT GTCCGACCTC ATGGCCACCA TGGATCACAA CAGCCCCGGC
GCGGAGATCA TCCGCAGCAT CCTCCGCTCC TGATCGGCAA GCAGCAGCAG CAAGCGGCAC CGGCCGGCCG GCCGGCCTAT
GTCGACGACG AGATAGGCCG GGCCGGCCGG GCAACGCCCG CGGCGCCAAT TAATCAAGCG TACGTCCTGC CGGCGCCATT
CTCCGGCCAC CAGAGAGCAT TTAGCTAGGG TATATATATC TACATATATA AAATATTTAT GTCGTATGTC CCTCCCCAAA
TGTACGAGCC ACGCTTACAC GCGCGTGTAT CGATCTCTCG ATCTCTCTCT CTAAGCTCCA CTCGAAGTAG GGCATTAGCA
CTAGGGGCCT AAGCAGAGGC TTATCCTCGC TTTAGCTCAT ATTTTCATCG CTTGATGTGT CCTCTCTGAA CCCCCACATC
TTGTCTTGTT TGGTTTTTCC CTCTCCCTTC CAATCTATGT AAATTTAGCT GGTGTGGTTT GGATCGAGTT GTGTCCTCTA
CAGACAACCG ACCGACCACT ACTACCTAGA GGAAATTAAT ATCATCATGG GTGTACTGCT CCAGCTTTAA CTTCAATTCA
GTTGGCTACG TACTACG