Os02t0749700-01

Locus

Os02g0749700

Description

Laccase, Lignin biosynthesis, Response to Cu stress of rice roots

RAP-DB Gene Symbol Synonym(s)

OsLAC10

RAP-DB Gene Name Synonym(s)

laccase 10

CGSNL Gene Symbol

LAC10

CGSNL Gene Name

LACCASE 10

Oryzabase Gene Symbol Synonym(s)

OsLAC10

Oryzabase Gene Name Synonym(s)

laccase 10

Transcript Evidence

Inferred from literature

Protein Evidence

Q6Z8L2

Literature

PMID: 28146098

Note

Manual Curation

December 4, 2017

Gene Ontology (GO)

Biological Process: lignin catabolic process (GO:0046274)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: copper ion binding (GO:0005507)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: hydroquinone:oxygen oxidoreductase activity (GO:0052716)

Cellular Component: apoplast (GO:0048046)

Functional domain (InterPro)

Cupredoxin (IPR008972)

Laccase (IPR017761)

Multicopper oxidase, type 3 (IPR011707)

Laccase, first cupredoxin domain (IPR034288)

Multicopper oxidase, type 1 (IPR001117)

Laccase, second cupredoxin domain (IPR034285)

Multicopper oxidase, type 2 (IPR011706)

Laccase, third cupredoxin domain (IPR034289)

Multicopper oxidases, conserved site (IPR033138)

Multicopper oxidase, copper-binding site (IPR002355)

Expression Databases

TENOR (Os02t0749700-00)

Others

Oryzabase (18571)

KEGG (Os02t0749700-00)

Transcript

2076 bp

>Os02t0749700-01 Laccase, Lignin biosynthesis, Response to Cu stress of rice roots
GCAGCTTACGGCACTAGTTAGCTACTGTGCAAGAACCAAACAGTTAATCGCATACAGAAT
CTCAATTAGCTCTGTGTTTCTTACCCTTGGATTGGCGATTGAATTGTGTGCGTTCGGCGA
TGGGAACAGCCAAGTTACCTGCATTGCTTTGGTTACTAGCAGGCGTGGTGTTAGCACTTG
CAGTTAACCCCGCTCATGGCGCCAAGACTCGCCACTACGATTTCTTCATTACGGAGACCA
ACTACACGAGGCTCTGCCACGAGAAGAGCATCCTCACCGTGAACGGGCAGTTCCCCGGCC
CGACCATCTACGCGCGCAAGGGCGACCTCGTCATCGTCAACGTCCACAACAACGGGAACA
AAAACATCACCATCCACTGGCACGGCGTGGACCAGCCACGGAACCCGTGGTCGGACGGGC
CGGAGTTCATCACGCAGTGCCCGATCCGGCCGGGCGGCAACTTCACCTACCAGGTGATCC
TGTCCGAGGAGGAGGGCACACTGTGGTGGCACGCGCACAGTGACTTCGACCGCGCCACCG
TCCACGGCGCCATCGTCATCCACCCCAAGCGCGGCACCACCTTCCCCTTCAAGAAGCCAG
ACAAGGAGATACCCGTCATCCTTGGTGAGTGGTGGAATGACGACATAGAGCACGTGCTCG
ACAAGGCGCAGCTCCTCGGCGGAGACGTGGATCCGTCCAACGCCAACACCATCAACGCCC
AGCCTGGGGACATGTTCCCCTGCTCCAGGGACGACACGTTCAAAGTGGCCGTGCAGCAGG
GCAACACGTACCTGCTTAGGATCATCAACGCTGGACTCACCAACGACATGTTCTTCGCCA
TCGCGGGGCACCGCCTCACCGTGGTCGGGATCGACGCCCGCTACACCAAGCCGCTCACAG
TCGACTACATCATGATCGCGCCTGGCCAGACCATGGACGTGCTCCTCGAGGCCAAACGCA
CCTTGGGATCCAACAGCCGGTATTACATGGCCGCGAGAACGTTTATCACGTTACCGCTCG
ACACTATCCCTTTCAACAATAGCACTGCCACGGCTATCGTGGAGTACACGGACAGCGTCA
CCGCGAGGCCGGTCGGGCCACCGGAATTCCCCGTCCAGCTGCCGGCCATCAAGGATGAGA
ACGCGGCGATGGCGTTCGTCACGCAGCTCAGATCATTAGGCAACCAGGAACACCCGGTGC
ACGTACCGACACATGTCGATGAGCACATGCTCATCGACATTGACATCAACGTTCTTCCCT
GCGACCCCACCAACATGGCAGAGAAGTGCAAAGAAGGACCCCAAGGCAACCGGTTCGCGG
CGAGCCTCAACAATGTTAGCTTCCAGAGCCCGGCTATCGACGTCCTCGACGCCTACTACT
ATAGCTCTGGCCACGGCGTGTACGAGGAGGACTTCCCCAACAAGCCGACAGCCTTCGTCG
ACCCGCCCGTCAACAACGGCAGTGGGCCCTTGATGACGAAGCGTGGCACCAAGGTGAAGG
TGCTGGAGTACGGCACTGTGGTAGAGGTGGTGTTTCATGACTTGTCCAGCGAGAACCACC
CTATGCATCTGCATGGCTTCGCCTTCTACGTCGTGGGACGAGGGAACGGCACCTTCGACG
AGAGCAGGGACCCGGCGACCTACAACCTCGTTGACCCGCCGTTCCAGAACACGGTCTCTG
TGCCCAGGTCCGGCTGGGCCGCAATCCGCTTCCGAGCAGACAATCCAGGTGTGTGGTTCA
TGCATTGCCATTTTGATCGCCACGTGGTGTGGGGGATGGACACTGTGTTCATCGTGAAGG
ACGGCAAGACACCGCAGGCTCAGATGCTGCCTCGTCCTCCAAACATGCCTCAGTGCTAAT
GACCGTGGTTCAAGGAAAATAACAAGAGCATGCATCACAAGCAAGCGGAAATTTGTTTAT
TTTGTTGATTGATTTAGTGGTTTATATTTTTTCCTTGTTTCGATGAAAAGGAAGAACGCA
TTCTGTCTTGACTTGTAATTGTTAGTCATTTCGTTCTGTCATGTAAGTTTGGGATTTTAT
GAATATAACTAAATAATGTTTATGTAGTGGATCGTT

CDS

1740 bp

>Os02t0749700-01 Laccase, Lignin biosynthesis, Response to Cu stress of rice roots
ATGGGAACAGCCAAGTTACCTGCATTGCTTTGGTTACTAGCAGGCGTGGTGTTAGCACTT
GCAGTTAACCCCGCTCATGGCGCCAAGACTCGCCACTACGATTTCTTCATTACGGAGACC
AACTACACGAGGCTCTGCCACGAGAAGAGCATCCTCACCGTGAACGGGCAGTTCCCCGGC
CCGACCATCTACGCGCGCAAGGGCGACCTCGTCATCGTCAACGTCCACAACAACGGGAAC
AAAAACATCACCATCCACTGGCACGGCGTGGACCAGCCACGGAACCCGTGGTCGGACGGG
CCGGAGTTCATCACGCAGTGCCCGATCCGGCCGGGCGGCAACTTCACCTACCAGGTGATC
CTGTCCGAGGAGGAGGGCACACTGTGGTGGCACGCGCACAGTGACTTCGACCGCGCCACC
GTCCACGGCGCCATCGTCATCCACCCCAAGCGCGGCACCACCTTCCCCTTCAAGAAGCCA
GACAAGGAGATACCCGTCATCCTTGGTGAGTGGTGGAATGACGACATAGAGCACGTGCTC
GACAAGGCGCAGCTCCTCGGCGGAGACGTGGATCCGTCCAACGCCAACACCATCAACGCC
CAGCCTGGGGACATGTTCCCCTGCTCCAGGGACGACACGTTCAAAGTGGCCGTGCAGCAG
GGCAACACGTACCTGCTTAGGATCATCAACGCTGGACTCACCAACGACATGTTCTTCGCC
ATCGCGGGGCACCGCCTCACCGTGGTCGGGATCGACGCCCGCTACACCAAGCCGCTCACA
GTCGACTACATCATGATCGCGCCTGGCCAGACCATGGACGTGCTCCTCGAGGCCAAACGC
ACCTTGGGATCCAACAGCCGGTATTACATGGCCGCGAGAACGTTTATCACGTTACCGCTC
GACACTATCCCTTTCAACAATAGCACTGCCACGGCTATCGTGGAGTACACGGACAGCGTC
ACCGCGAGGCCGGTCGGGCCACCGGAATTCCCCGTCCAGCTGCCGGCCATCAAGGATGAG
AACGCGGCGATGGCGTTCGTCACGCAGCTCAGATCATTAGGCAACCAGGAACACCCGGTG
CACGTACCGACACATGTCGATGAGCACATGCTCATCGACATTGACATCAACGTTCTTCCC
TGCGACCCCACCAACATGGCAGAGAAGTGCAAAGAAGGACCCCAAGGCAACCGGTTCGCG
GCGAGCCTCAACAATGTTAGCTTCCAGAGCCCGGCTATCGACGTCCTCGACGCCTACTAC
TATAGCTCTGGCCACGGCGTGTACGAGGAGGACTTCCCCAACAAGCCGACAGCCTTCGTC
GACCCGCCCGTCAACAACGGCAGTGGGCCCTTGATGACGAAGCGTGGCACCAAGGTGAAG
GTGCTGGAGTACGGCACTGTGGTAGAGGTGGTGTTTCATGACTTGTCCAGCGAGAACCAC
CCTATGCATCTGCATGGCTTCGCCTTCTACGTCGTGGGACGAGGGAACGGCACCTTCGAC
GAGAGCAGGGACCCGGCGACCTACAACCTCGTTGACCCGCCGTTCCAGAACACGGTCTCT
GTGCCCAGGTCCGGCTGGGCCGCAATCCGCTTCCGAGCAGACAATCCAGGTGTGTGGTTC
ATGCATTGCCATTTTGATCGCCACGTGGTGTGGGGGATGGACACTGTGTTCATCGTGAAG
GACGGCAAGACACCGCAGGCTCAGATGCTGCCTCGTCCTCCAAACATGCCTCAGTGCTAA

Protein

580 aa

>Os02t0749700-01 Laccase, Lignin biosynthesis, Response to Cu stress of rice roots
MGTAKLPALLWLLAGVVLALAVNPAHGAKTRHYDFFITETNYTRLCHEKSILTVNGQFPG
PTIYARKGDLVIVNVHNNGNKNITIHWHGVDQPRNPWSDGPEFITQCPIRPGGNFTYQVI
LSEEEGTLWWHAHSDFDRATVHGAIVIHPKRGTTFPFKKPDKEIPVILGEWWNDDIEHVL
DKAQLLGGDVDPSNANTINAQPGDMFPCSRDDTFKVAVQQGNTYLLRIINAGLTNDMFFA
IAGHRLTVVGIDARYTKPLTVDYIMIAPGQTMDVLLEAKRTLGSNSRYYMAARTFITLPL
DTIPFNNSTATAIVEYTDSVTARPVGPPEFPVQLPAIKDENAAMAFVTQLRSLGNQEHPV
HVPTHVDEHMLIDIDINVLPCDPTNMAEKCKEGPQGNRFAASLNNVSFQSPAIDVLDAYY
YSSGHGVYEEDFPNKPTAFVDPPVNNGSGPLMTKRGTKVKVLEYGTVVEVVFHDLSSENH
PMHLHGFAFYVVGRGNGTFDESRDPATYNLVDPPFQNTVSVPRSGWAAIRFRADNPGVWF
MHCHFDRHVVWGMDTVFIVKDGKTPQAQMLPRPPNMPQC*

5'UTR

chr02:31517666..31517784 (- strand) : 119 bp

CDS

chr02:31517558..31517665 (- strand) : 108 bp

chr02:31517296..31517447 (- strand) : 152 bp

chr02:31516955..31517199 (- strand) : 245 bp

chr02:31515742..31516845 (- strand) : 1104 bp

chr02:31515518..31515648 (- strand) : 131 bp

3'UTR

chr02:31515301..31515517 (- strand) : 217 bp

FASTA

>Os02t0749700-01 class=Sequence position=chr02:31515301..31517784 (- strand)
GCAGCTTACG GCACTAGTTA GCTACTGTGC AAGAACCAAA CAGTTAATCG CATACAGAAT CTCAATTAGC TCTGTGTTTC
TTACCCTTGG ATTGGCGATT GAATTGTGTG CGTTCGGCGA TGGGAACAGC CAAGTTACCT GCATTGCTTT GGTTACTAGC
AGGCGTGGTG TTAGCACTTG CAGTTAACCC CGCTCATGGC GCCAAGACTC GCCACTACGA TTTCTTCGTA AGTGATCTAC
TTGAATTCTA GCGTGTTCAC TGATGGATGC CGATGTACAG GCATGAATGC ACGAAATGAG TTTTGAGTTT TAACCATGCG
TGATGCCCCC CCTGCAGATT ACGGAGACCA ACTACACGAG GCTCTGCCAC GAGAAGAGCA TCCTCACCGT GAACGGGCAG
TTCCCCGGCC CGACCATCTA CGCGCGCAAG GGCGACCTCG TCATCGTCAA CGTCCACAAC AACGGGAACA AAAACATCAC
CATCCACTGG TAAACCACAT CCGTTTTGCC ACCTGCTGCA GAGAAGAAGA GCATTATCCT TGGCTCGAAA CTTACGGTGT
TCTCGATGAT TTTACTGTGG CGCAGGCACG GCGTGGACCA GCCACGGAAC CCGTGGTCGG ACGGGCCGGA GTTCATCACG
CAGTGCCCGA TCCGGCCGGG CGGCAACTTC ACCTACCAGG TGATCCTGTC CGAGGAGGAG GGCACACTGT GGTGGCACGC
GCACAGTGAC TTCGACCGCG CCACCGTCCA CGGCGCCATC GTCATCCACC CCAAGCGCGG CACCACCTTC CCCTTCAAGA
AGCCAGACAA GGAGATACCC GTCATCCTTG GTATACACAA GCCACAACAA ACTAATCTTG TTAATTTGAT AATGTTCCAT
TGCGCAATGC AATGCTTCGT ACGTGTTTTG ATCTTAACCA TCTCTATGAT GTTCTGCAGG TGAGTGGTGG AATGACGACA
TAGAGCACGT GCTCGACAAG GCGCAGCTCC TCGGCGGAGA CGTGGATCCG TCCAACGCCA ACACCATCAA CGCCCAGCCT
GGGGACATGT TCCCCTGCTC CAGGGACGAC ACGTTCAAAG TGGCCGTGCA GCAGGGCAAC ACGTACCTGC TTAGGATCAT
CAACGCTGGA CTCACCAACG ACATGTTCTT CGCCATCGCG GGGCACCGCC TCACCGTGGT CGGGATCGAC GCCCGCTACA
CCAAGCCGCT CACAGTCGAC TACATCATGA TCGCGCCTGG CCAGACCATG GACGTGCTCC TCGAGGCCAA ACGCACCTTG
GGATCCAACA GCCGGTATTA CATGGCCGCG AGAACGTTTA TCACGTTACC GCTCGACACT ATCCCTTTCA ACAATAGCAC
TGCCACGGCT ATCGTGGAGT ACACGGACAG CGTCACCGCG AGGCCGGTCG GGCCACCGGA ATTCCCCGTC CAGCTGCCGG
CCATCAAGGA TGAGAACGCG GCGATGGCGT TCGTCACGCA GCTCAGATCA TTAGGCAACC AGGAACACCC GGTGCACGTA
CCGACACATG TCGATGAGCA CATGCTCATC GACATTGACA TCAACGTTCT TCCCTGCGAC CCCACCAACA TGGCAGAGAA
GTGCAAAGAA GGACCCCAAG GCAACCGGTT CGCGGCGAGC CTCAACAATG TTAGCTTCCA GAGCCCGGCT ATCGACGTCC
TCGACGCCTA CTACTATAGC TCTGGCCACG GCGTGTACGA GGAGGACTTC CCCAACAAGC CGACAGCCTT CGTCGACCCG
CCCGTCAACA ACGGCAGTGG GCCCTTGATG ACGAAGCGTG GCACCAAGGT GAAGGTGCTG GAGTACGGCA CTGTGGTAGA
GGTGGTGTTT CATGACTTGT CCAGCGAGAA CCACCCTATG CATCTGCATG GCTTCGCCTT CTACGTCGTG GGACGAGGGA
ACGGCACCTT CGACGAGAGC AGGGACCCGG CGACCTACAA CCTCGTTGAC CCGCCGTTCC AGAACACGGT CTCTGTGCCC
AGGTCCGGCT GGGCCGCAAT CCGCTTCCGA GCAGACAATC CAGGTGAGAG TTATTCAGAT TTCGGATTAT GGTCTTTGAT
ATTGGTCTTT ATGTACAGTT TTTAATATTT TTTTCGTGTT TATTTTGATT GTTCAGGTGT GTGGTTCATG CATTGCCATT
TTGATCGCCA CGTGGTGTGG GGGATGGACA CTGTGTTCAT CGTGAAGGAC GGCAAGACAC CGCAGGCTCA GATGCTGCCT
CGTCCTCCAA ACATGCCTCA GTGCTAATGA CCGTGGTTCA AGGAAAATAA CAAGAGCATG CATCACAAGC AAGCGGAAAT
TTGTTTATTT TGTTGATTGA TTTAGTGGTT TATATTTTTT CCTTGTTTCG ATGAAAAGGA AGAACGCATT CTGTCTTGAC
TTGTAATTGT TAGTCATTTC GTTCTGTCAT GTAAGTTTGG GATTTTATGA ATATAACTAA ATAATGTTTA TGTAGTGGAT
CGTT