Os02t0753800-01

Locus

Os02g0753800

Description

Calcium-binding protein, Annexin, Heat and drought stress tolerance

RAP-DB Gene Symbol Synonym(s)

ANN2, OsANN2

RAP-DB Gene Name Synonym(s)

ANNEXIN 2, Annexin 2

CGSNL Gene Symbol

ANN2

CGSNL Gene Name

ANNEXIN 2

Oryzabase Gene Symbol Synonym(s)

OsANN2, OsANN1, ANN1

Oryzabase Gene Name Synonym(s)

Annexin 2, annexin 1

Transcript Evidence

AK101787

Protein Evidence

Q6Z6A7

Literature

PMID: 26085678

PMID: 24286292

Note

Manual Curation

May 31, 2016

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: calcium-dependent phospholipid binding (GO:0005544)

Functional domain (InterPro)

Annexin (IPR001464)

Annexin, plant (IPR009118)

Annexin repeat (IPR018502)

Annexin repeat, conserved site (IPR018252)

Full-length cDNA

J033065F07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0753800-01)

RiceXPro (AK101787)

Others

Oryzabase (15465)

KEGG (Os02t0753800-01)

Transcript

1222 bp

>Os02t0753800-01 Calcium-binding protein, Annexin, Heat and drought stress tolerance
CTCCCCGCCGCATAAATCCCCTTCGCCTCCCCGCCGCGCCCCGCGGCGTCGCACGATCTC
ACTGAGGCATAAAGTGAGAGACCGTGATTGGATCGATCACCGGAGCGACGATCAATGGCG
ACGCTCACCGTGCCCGCCGCCGTGCCGCCCGTCGCCGAGGACTGCGAGCAGCTGCGCAAG
GCGTTCAAAGGGTGGGGCACGAACGAGAAGCTCATCATCTCCATCCTCGCCCACCGCGAC
GCGGCGCAGCGCCGGGCGATCCGCCGCGCCTACGCCGAGGCGTACGGCGAGGAGCTGCTC
CGCGCCCTCAACGACGAGATCCACGGCAAATTCGAGAGGGCGGTGATCCAGTGGACGCTG
GACCCGGCGGAGCGGGACGCGGTGCTGGCGAACGAGGAGGCGAGGAAGTGGCACCCGGGG
GGCCGCGCGCTCGTCGAGATCGCGTGCACGCGCACTCCATCGCAGCTCTTCGCTGCGAAG
CAGGCGTACCACGAGCGCTTCAAGAGGTCGCTCGAGGAGGACGTCGCGGCGCACATCACC
GGCGACTACCGTAAGCTTTTGGTGCCACTTGTGACTGTATATCGCTATGATGGGCCAGAG
GTGAACACATCGTTGGCACATTCTGAAGCCAAAATACTCCATGAGAAGATCCATGACAAG
GCTTACAGTGACGATGAAATCATCAGGATTCTCACCACAAGGAGCAAAGCACAGTTACTA
GCAACATTCAATAGTTACAATGATCAGTTCGGCCATCCAATCACTAAGGATCTTAAAGCT
GATCCTAAGGACGAGTTCCTTGGTACACTAAGGGCGATCATAAGATGCTTCACTTGCCCT
GACAGATACTTTGAGAAAGTCATTCGATTGGCTCTAGGAGGAATGGGCACAGACGAGAAC
TCTCTTACAAGGATCATAACAACTCGTGCCGAGGTAGACCTGAAGCTGATAAAGGAGGCC
TACCAGAAGAGAAACAGTGTCCCATTGGAGCGAGCTGTTGCTAAAGATACAACCAGAGAC
TACGAGGATATACTCCTTGCCCTCCTTGGAGCAGAGTGAGGTGTATATCTGCTCCATCTC
GTCTGTCTGATCCTCCTTGTTTGATCGGAAAATAAGATCTGCATAGAACTGTGTTCTATT
TTGTTGTTTCTGAATGATACAAGTGAGCTAGTCTGCATAGCAGTGCTCATATAATAAAAT
CTGTCCTGCATACTGGTTTGTC

CDS

945 bp

>Os02t0753800-01 Calcium-binding protein, Annexin, Heat and drought stress tolerance
ATGGCGACGCTCACCGTGCCCGCCGCCGTGCCGCCCGTCGCCGAGGACTGCGAGCAGCTG
CGCAAGGCGTTCAAAGGGTGGGGCACGAACGAGAAGCTCATCATCTCCATCCTCGCCCAC
CGCGACGCGGCGCAGCGCCGGGCGATCCGCCGCGCCTACGCCGAGGCGTACGGCGAGGAG
CTGCTCCGCGCCCTCAACGACGAGATCCACGGCAAATTCGAGAGGGCGGTGATCCAGTGG
ACGCTGGACCCGGCGGAGCGGGACGCGGTGCTGGCGAACGAGGAGGCGAGGAAGTGGCAC
CCGGGGGGCCGCGCGCTCGTCGAGATCGCGTGCACGCGCACTCCATCGCAGCTCTTCGCT
GCGAAGCAGGCGTACCACGAGCGCTTCAAGAGGTCGCTCGAGGAGGACGTCGCGGCGCAC
ATCACCGGCGACTACCGTAAGCTTTTGGTGCCACTTGTGACTGTATATCGCTATGATGGG
CCAGAGGTGAACACATCGTTGGCACATTCTGAAGCCAAAATACTCCATGAGAAGATCCAT
GACAAGGCTTACAGTGACGATGAAATCATCAGGATTCTCACCACAAGGAGCAAAGCACAG
TTACTAGCAACATTCAATAGTTACAATGATCAGTTCGGCCATCCAATCACTAAGGATCTT
AAAGCTGATCCTAAGGACGAGTTCCTTGGTACACTAAGGGCGATCATAAGATGCTTCACT
TGCCCTGACAGATACTTTGAGAAAGTCATTCGATTGGCTCTAGGAGGAATGGGCACAGAC
GAGAACTCTCTTACAAGGATCATAACAACTCGTGCCGAGGTAGACCTGAAGCTGATAAAG
GAGGCCTACCAGAAGAGAAACAGTGTCCCATTGGAGCGAGCTGTTGCTAAAGATACAACC
AGAGACTACGAGGATATACTCCTTGCCCTCCTTGGAGCAGAGTGA

Protein

315 aa

>Os02t0753800-01 Calcium-binding protein, Annexin, Heat and drought stress tolerance
MATLTVPAAVPPVAEDCEQLRKAFKGWGTNEKLIISILAHRDAAQRRAIRRAYAEAYGEE
LLRALNDEIHGKFERAVIQWTLDPAERDAVLANEEARKWHPGGRALVEIACTRTPSQLFA
AKQAYHERFKRSLEEDVAAHITGDYRKLLVPLVTVYRYDGPEVNTSLAHSEAKILHEKIH
DKAYSDDEIIRILTTRSKAQLLATFNSYNDQFGHPITKDLKADPKDEFLGTLRAIIRCFT
CPDRYFEKVIRLALGGMGTDENSLTRIITTRAEVDLKLIKEAYQKRNSVPLERAVAKDTT
RDYEDILLALLGAE*

5'UTR

chr02:31700325..31700438 (- strand) : 114 bp

CDS

chr02:31700249..31700324 (- strand) : 76 bp

chr02:31700004..31700149 (- strand) : 146 bp

chr02:31699689..31699907 (- strand) : 219 bp

chr02:31698907..31699119 (- strand) : 213 bp

chr02:31698367..31698657 (- strand) : 291 bp

3'UTR

chr02:31698204..31698366 (- strand) : 163 bp

FASTA

>Os02t0753800-01 class=Sequence position=chr02:31698204..31700438 (- strand)
CTCCCCGCCG CATAAATCCC CTTCGCCTCC CCGCCGCGCC CCGCGGCGTC GCACGATCTC ACTGAGGCAT AAAGTGAGAG
ACCGTGATTG GATCGATCAC CGGAGCGACG ATCAATGGCG ACGCTCACCG TGCCCGCCGC CGTGCCGCCC GTCGCCGAGG
ACTGCGAGCA GCTGCGCAAG GCGTTCAAAG GTCAGGCGCG CGCTCCGCCG TCCTCGCCTT AATCCTCCGC CGGCCGGCGC
GAGGCCGGAC CGGGTGCTGA CGCGATCTGC TTTACTGGTG GTCCCGCAGG GTGGGGCACG AACGAGAAGC TCATCATCTC
CATCCTCGCC CACCGCGACG CGGCGCAGCG CCGGGCGATC CGCCGCGCCT ACGCCGAGGC GTACGGCGAG GAGCTGCTCC
GCGCCCTCAA CGACGAGATC CACGGCAAAT TCGAGGTCCC CGATCTAGCT TGTGCGGATT AATCGGCTCC CCCCTTTAGC
TCCGTCGCTA TCTGTCTGAT TTGATTCGTG TGGGGGTTGG GATTTTGTCA GAGGGCGGTG ATCCAGTGGA CGCTGGACCC
GGCGGAGCGG GACGCGGTGC TGGCGAACGA GGAGGCGAGG AAGTGGCACC CGGGGGGCCG CGCGCTCGTC GAGATCGCGT
GCACGCGCAC TCCATCGCAG CTCTTCGCTG CGAAGCAGGC GTACCACGAG CGCTTCAAGA GGTCGCTCGA GGAGGACGTC
GCGGCGCACA TCACCGGCGA CTACCGTAAG GTGATGATCC TGAATCTATC ATCTACCACG GAGTTCTTGA AATTTTGATA
GATCGATATC TCTGTCATAA TCACAGAAAC CATGAATTTT ACACTTGCTG CTATGCTTCT CAGGGATATA CGAGATGTTT
ATCATGACAA TAGACTTATG CGAGATGTTT ACTTCTTGAT CTCCTTGTTC TCATGATTAG TATGTAGTGT ATAGTGGATA
ACTCAATATT GAAGATGAAT TGTTTTGCTA AGGATCTAAA TCATCTCTTC AATTTAACTC TAGTATACTG CAATTCCACT
TTTTTTATTT GTATTTTGTG TGGGCATTGA TAAATGGTAA CGTAGTTCTT AGATGATCAT ATCTGAGAAG ATAATGCAGT
TACTAGCTGT GTGAGATGAT ATCACTTCAG TTACCCTGGT CTGTATACTA GAATGTGACC ATCTCCTCAG TTTACGTTGA
CTGGACCATT TTATTATTGT GCTTTAAAAT TTGTGACATA CTACTAAATT GCATACGTCA ATGCTAAAAA AAGAACACCC
TTGTTACCAA AATGAATTAT TTTTATTTCT TTCTTGCAGC TTTTGGTGCC ACTTGTGACT GTATATCGCT ATGATGGGCC
AGAGGTGAAC ACATCGTTGG CACATTCTGA AGCCAAAATA CTCCATGAGA AGATCCATGA CAAGGCTTAC AGTGACGATG
AAATCATCAG GATTCTCACC ACAAGGAGCA AAGCACAGTT ACTAGCAACA TTCAATAGTT ACAATGATCA GTTCGGCCAT
CCAATCACTA AGGTAATAAT AGCATTGATA ACCGTTTTTT TTCCCGTTGA AAAACATTTT ACTTACCATT CCTTGTCCAA
TCACTAAGCT GAATGATAAC ATGCATTGTA TTGAAATGTT TCATTCAGTA ACATGCCATT GTTTGCACTG AACATGGTAT
TTTAGGAACT GAAATTATTA CACATTGCTA GTGGTCCATA ATGTCGTTTG CCGACCTGTC CTTGTCTGAA ACTCTTCTAA
CACATTCTGG CACACTGACA GGATCTTAAA GCTGATCCTA AGGACGAGTT CCTTGGTACA CTAAGGGCGA TCATAAGATG
CTTCACTTGC CCTGACAGAT ACTTTGAGAA AGTCATTCGA TTGGCTCTAG GAGGAATGGG CACAGACGAG AACTCTCTTA
CAAGGATCAT AACAACTCGT GCCGAGGTAG ACCTGAAGCT GATAAAGGAG GCCTACCAGA AGAGAAACAG TGTCCCATTG
GAGCGAGCTG TTGCTAAAGA TACAACCAGA GACTACGAGG ATATACTCCT TGCCCTCCTT GGAGCAGAGT GAGGTGTATA
TCTGCTCCAT CTCGTCTGTC TGATCCTCCT TGTTTGATCG GAAAATAAGA TCTGCATAGA ACTGTGTTCT ATTTTGTTGT
TTCTGAATGA TACAAGTGAG CTAGTCTGCA TAGCAGTGCT CATATAATAA AATCTGTCCT GCATACTGGT TTGTC

Locus: Os02g0753800

Loading...

Locus: Os02g0753800

Loading...