Os02t0757900-01

Locus

Os02g0757900

Description

Similar to Poly(A)-binding protein II-like.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PABN1

CGSNL Gene Name

POLY (A) BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsPABN1

Oryzabase Gene Name Synonym(s)

poly (A) binding protein 1

Transcript Evidence

AK061269 (DDBJ, Best hit)

Protein Evidence

B4FHB3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Nucleotide-binding, alpha-beta plait (IPR012677)

Full-length cDNA

006-212-D06 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0757900-01)

RiceXPro (AK061269)

Others

Oryzabase (22837)

KEGG (Os02t0757900-01)

Transcript

1075 bp

>Os02t0757900-01 Similar to Poly(A)-binding protein II-like.
CCTTGCCAAAAGTCACGAACACCAAAGGAGAGACCCGAGTCAGATTGGGGATCGACGAAG
GTGGGGAGGGGCGAACGCCATGGACGAGGAGGAGCACGAGGTGTACGGGCAAGAGATCCC
GGAGGACGGGGACATGGACGGCGCGGACGTCGACATGGCCTCCGGCGGGGACGACGCCGC
GAAGCTGCAGGAGCTCGACCAGATGAAGCGAAGGCTGAAGGAGATGGAGGAAGAGGCCGC
GGCCCTCCGCGACATGCAGGCCAAGGTCGCCAAGGAGATGCAAGGAGGAGATCCTAGCGC
GTCTACAGCTGAGGCAAAGGAGCAGGTGGATGCTCGATCTGTGTATGTTGGAAATGTTGA
TTATGCATGTACCCCAGAAGAAGTGCAGCAGCATTTTCAAGCGTGTGGCACAGTCAATAG
AGTGACGATCTTAACTGACAAGTTTGGACAGCCAAAAGGTTTTGCTTATGTGGAATTTCT
GGAACAAGAAGCAGTTCAGGAGGCTCTGAATTTGAATGAATCTGAACTGCATGGTCGTCA
GATAAAGGTGGCACCAAAGAGGACTAATGTCCCTGGGATGAAGCAGCGTCCACCGCGTGG
ATACAATCCTTATCATGGTTACCCATATAGATCGTATGGGGCCCCATATTTCCCACCATA
TGGTTACGGGAGAGTCCCCAGATTCCGCCGTCCAATGCGCTACAGGCCATACTTTTGAAG
TAAGAGGTTTTCATGACGTGGAACACAACACCAAGCCTAGTCGCTAGTCAGCCAAGTCGG
TCCCAGAAATAATTCTACTATCTGGTATTTTAGTTTCCCAGCAGACATGCTGGGTGAATG
CTTCCACCCCCACCATATTCCATTTTGGTAACGTCCGCTCACTAGTTATCAGTATCTTGT
ATCGTTGGTTCTGCAGTACGCAAAACGTAGTGTTATCTTATTATATTATATATACCTGCA
TCATATGATATTGGTTTGCCATACTTGGTAATATGTCTGGATATAAGCGTGGGATTGTGA
TGGTTGATTACAGCCCTTATCAGAAGCGATGATGCTTGGGTACAACAAGATTGCT

CDS

639 bp

>Os02t0757900-01 Similar to Poly(A)-binding protein II-like.
ATGGACGAGGAGGAGCACGAGGTGTACGGGCAAGAGATCCCGGAGGACGGGGACATGGAC
GGCGCGGACGTCGACATGGCCTCCGGCGGGGACGACGCCGCGAAGCTGCAGGAGCTCGAC
CAGATGAAGCGAAGGCTGAAGGAGATGGAGGAAGAGGCCGCGGCCCTCCGCGACATGCAG
GCCAAGGTCGCCAAGGAGATGCAAGGAGGAGATCCTAGCGCGTCTACAGCTGAGGCAAAG
GAGCAGGTGGATGCTCGATCTGTGTATGTTGGAAATGTTGATTATGCATGTACCCCAGAA
GAAGTGCAGCAGCATTTTCAAGCGTGTGGCACAGTCAATAGAGTGACGATCTTAACTGAC
AAGTTTGGACAGCCAAAAGGTTTTGCTTATGTGGAATTTCTGGAACAAGAAGCAGTTCAG
GAGGCTCTGAATTTGAATGAATCTGAACTGCATGGTCGTCAGATAAAGGTGGCACCAAAG
AGGACTAATGTCCCTGGGATGAAGCAGCGTCCACCGCGTGGATACAATCCTTATCATGGT
TACCCATATAGATCGTATGGGGCCCCATATTTCCCACCATATGGTTACGGGAGAGTCCCC
AGATTCCGCCGTCCAATGCGCTACAGGCCATACTTTTGA

Protein

213 aa

>Os02t0757900-01 Similar to Poly(A)-binding protein II-like.
MDEEEHEVYGQEIPEDGDMDGADVDMASGGDDAAKLQELDQMKRRLKEMEEEAAALRDMQ
AKVAKEMQGGDPSASTAEAKEQVDARSVYVGNVDYACTPEEVQQHFQACGTVNRVTILTD
KFGQPKGFAYVEFLEQEAVQEALNLNESELHGRQIKVAPKRTNVPGMKQRPPRGYNPYHG
YPYRSYGAPYFPPYGYGRVPRFRRPMRYRPYF*

5'UTR

chr02:31920523..31920601 (- strand) : 79 bp

CDS

chr02:31920418..31920522 (- strand) : 105 bp

chr02:31920227..31920326 (- strand) : 100 bp

chr02:31919196..31919266 (- strand) : 71 bp

chr02:31916835..31917026 (- strand) : 192 bp

chr02:31916603..31916724 (- strand) : 122 bp

chr02:31916472..31916520 (- strand) : 49 bp

3'UTR

chr02:31916115..31916471 (- strand) : 357 bp

FASTA

>Os02t0757900-01 class=Sequence position=chr02:31916115..31920601 (- strand)
CCTTGCCAAA AGTCACGAAC ACCAAAGGAG AGACCCGAGT CAGATTGGGG ATCGACGAAG GTGGGGAGGG GCGAACGCCA
TGGACGAGGA GGAGCACGAG GTGTACGGGC AAGAGATCCC GGAGGACGGG GACATGGACG GCGCGGACGT CGACATGGCC
TCCGGCGGGG ACGACGCCGC GAAGGTCTCC CTACCTCCAT GATCCGCGCA TCTATGGTCT ATGAACCTAA CCCTACTTCG
AGTAGCTGAC TACTACCCCA TTTGGCTTGT TGCAGCTGCA GGAGCTCGAC CAGATGAAGC GAAGGCTGAA GGAGATGGAG
GAAGAGGCCG CGGCCCTCCG CGACATGCAG GCCAAGGTCG CCAAGGAGAT GCAAGGTGGT CCGCCGGGTG TGCTCACTGC
CTGCCTAATT TTTACTGATG CTTTTATGTT TTTCTTGTTG CGATCTGCTA TGTTCATATC GGCCTCATTC GATCTGTATT
GTGAGGATCT ACGTGTACCC TAGGTTAGAT GACTATCTGA TCAAGTTTAA AACTTATTAA GGTCCCTCAA TTTCGACTAG
GTTAACTTGG TGAGGTTAGA TCGATCGGCC GTTAATTCGT GCCCTACTCT GATAGTCTGA TTTAGGAATT GGTACTTCCG
AGTTCCAAAT ATGTATATTT GGGTTAACTT TTGCTACTTA ACATTTCAAC CACGATCCAA TCTGCTTGAA TATAAGGTTT
CGGATTTCTT CATTTTTGTT GTTGACTGTG CCCTTATATT TTGGGATATA CACATATTTT TACTTGTTAG TCCATGTGGC
TAGAAATCTC AGTCTACCCC TATATTATCA TTTGAGTGTA TATATCTGGA CAAGTCATGG AGGTTTTGGA ttaggggcct
gttcactttg atgccaaaaa aaaccttacc aaattttggc attaccaaaa ttttggcaaa ctatgccaaa attttggtag
gatttcttat atagttgcca aattttggca gcaaactaaa tgtagccttt ttttttttga caattttacc aaaatttggt
aaggttgaaa atgacatcaa aatgaacagg ccctAGGATT TACTTTGGTT TTGTCTTCAA ATGATTAGTA TTATGGGCCT
GCTTGCCCCG CTGCCTGCAC CAGGTTCGCT GGCTGCAGCA GCTAAGCAGC AGCAAGCTGT GAGGCAGCAA TTCACCCATA
AAACACTTCA AACATCTATA TCTGAATGTG CCTTGACCCG ATGTTCTATT TCCCACATTT TCAGTTTTCT GATAGGTACT
AGTTGGTAAG TTTCCATTGC AACTTCTCTA ATGCTATTAC TCTTTTGTTT TGTAGGAGGA GATCCTAGCG CGTCTACAGC
TGAGGCAAAG GAGCAGGTGG ATGCTCGATC TGTGTATGTT GGAAATGTAA GAATTTATAA AGACCCATAC TCTCTCTCAC
ACACACGTTT CATATGATGG AAACTGTAAG ctactccctc ggtcccaaaa ggaatttcac tctaggattc aaaattcgtc
gcacaaagat tgtcactcta gggtactact tgtcccatca atcacctctc attcaaattt ctccccatac tatccccaac
cacacatcat tatataaggg gtagtatagt cttttctcct caaaccttaa gtctctgcta aacaccctag aatgtctttc
ttttgggatg gagggagTCC TATTTAGTTG CATTGATAAC TACCACATTT TTTAGCACTA AATGTGGAAT ACATGGATAT
ATGTACAGTG TAACATATCA TTAGATATTT TCTGCTGGTT CCTTGCTAGT TGAAAGATAC CTTTGGTACA TTTCACTTAG
ATATGACATA CTTGTGCCAA ATTATATAGC TCTCCTAGCC CCCCCCCTTT CACCCCACCA CATACACATC CAAAAACAAA
TGCTTGTTTT GTTTTCTCGA CTTCCCTTAA GCTCACCTAA TAGCCTGCCT TATCTCCGAA AATTAGTTTA CTTCTGCTTG
TCTTAAATGT CAGAAGACAT CATTAAAGCT ATCAAAAATT GGGTTTCTCT CTTCATTTTA ATCCATGCTT AATACTGTTC
ATTCGAACAA CAAAACATAA ATTTCCATGC ACAGTTTTGT ACTGTTGTTG TGATTTTTCC TCTGTGCTTA TTGCCGTTCT
GTTTCTAATG ATAGTAGAAG ATAGTATCTT ATATGGCTAT ATGGTGAATA TGCCTTGTTT TGGTGCATTG ATTGAATAAT
GGTGATGGCC GCAGGGTAGT GCTGAGATCA AGCCTTTCTC AAATCGAGTA ATTGGCATCT GGTTGAACAC CTGCCTGCAT
TTTAGTATTA GCTTAGAATT GAAAAAAAAA AGAGAAATTC CCTGAAAAAA ATAAAAAGAG CATGGGCAAA AAGGAAAAAA
AAAAGAGCAT GGGCAAAAGA AAAAGAAAAA AGGGAAAAAA ACAAACATGA ATATTCTAGG ATAGGTTATC CTTGAAGGAG
CAAAGGAAGT CTAGAAAGCA GCTGTACACT CCTTGGTGCT TGAGACTCGA ACCTGCATAC GATGTGATGT GATTCTTAGC
GACTGGTCCA ATGAGAATCA CCTGAATACA CATAGGTATG ACATATAAGC CTAATATTAG GGAGCCTTCA TATTAACTTT
ATTCATCTTT GTATCTCCAT CTTTCCTTTT TTTTTTACTT CTCTTGTGAT GTCAAAGCAC ATCTTTCTAT TTCTTTTGCC
CCCTTTTCAT TGACCACCTT AATTATTCTT GATGACATTG CTGATGTGTC AGCATAAATG TCAGTATTGT TTTGTGGGGA
CTACATTGAA CTTTTCTTAC AAGCAAGTAA AGGCTACCCA GTATTCTAGT AGCCCAAATG GGTGACATCA TGAAAATTAA
CCTTTTGTTC AGTAAATGCT ATGGAAGTCA GTAATTTGTA TGAAAATTTA ACAGCACTTG CATATGTTTA ACAAAAATCC
TTTTAACTAT GACATTTATA TTTTCCTGAA AGTCTTGCCG TACAGACTAT ACTGTACGAT AGTCCTAGAA ATTGCATCAT
CTATGCTAGT TTTTGCCTTG TTAGCATGAT ATTGTGCTTT TCTCTTCGCT TCAGAGTTCA GTATGTCTGG TCTCATACTC
CATTTGTCAC ATCACGGGCA CAATTATATT ATTTACAATT ATGATATTCC TAGATAATCA GTTATATGAT GTTCCCCTTA
TAATGTTTCC AACTTTCGAA GTGGTAGTTA CACCCAAAGT GTCATCTTGA CTGGGTTTAG CCTGAAACAC ACTTTAAACA
TTGATTTTTG TTGACCTGAA ATTTCCTCAC CTGTGTATCA ACCATGTGAA ATTTTCAATT AGTATCAGGC ATGGCAATTT
TGTATTGTAC CGAGGTATCT TATGTAGCAC ACTGAAACCT TTAAAAGGCA GAAATGGTTC TTTTGAGATT AACCGGTTAA
AATCAGAATA TTATCAAGGT GACTTGATAA GCATTTTTTT AATTCTATTA CCAGTCTGCA AGCACATCTG ATTATCTAAT
CTGACATGTA CATTTAGTTT TCATTCATCT TAGTGATACA AATCATTTAC CGCAGGTTGA TTATGCATGT ACCCCAGAAG
AAGTGCAGCA GCATTTTCAA GCGTGTGGCA CAGTCAATAG AGTGACGATC TTAACTGACA AGTTTGGACA GCCAAAAGGT
TTTGCTTATG TGGAATTTCT GGAACAAGAA GCAGTTCAGG AGGCTCTGAA TTTGAATGAA TCTGAACTGC ATGGTCGTCA
GATAAAGGTG CAGAAATTAC CAACAGATCC CTGTTTTGTC ACCTGAAGGA TTCAAAAACT CCTTTTCACA TGTTTTTGTC
CTCGCAATTT ACTCAATTTC TGTTTTGTGC TCAACAGGTG GCACCAAAGA GGACTAATGT CCCTGGGATG AAGCAGCGTC
CACCGCGTGG ATACAATCCT TATCATGGTT ACCCATATAG ATCGTATGGG GCCCCATATT TCCCACCATA TGGTTACGGG
TAAGTTTAGC TTTTTTGACA ACATGGATGT CTAATTCTTT ATGTCTGGTG TCTAACATCC ATATTGTGTA TTCTTGTTCA
GGAGAGTCCC CAGATTCCGC CGTCCAATGC GCTACAGGCC ATACTTTTGA AGTAAGAGGT TTTCATGACG TGGAACACAA
CACCAAGCCT AGTCGCTAGT CAGCCAAGTC GGTCCCAGAA ATAATTCTAC TATCTGGTAT TTTAGTTTCC CAGCAGACAT
GCTGGGTGAA TGCTTCCACC CCCACCATAT TCCATTTTGG TAACGTCCGC TCACTAGTTA TCAGTATCTT GTATCGTTGG
TTCTGCAGTA CGCAAAACGT AGTGTTATCT TATTATATTA TATATACCTG CATCATATGA TATTGGTTTG CCATACTTGG
TAATATGTCT GGATATAAGC GTGGGATTGT GATGGTTGAT TACAGCCCTT ATCAGAAGCG ATGATGCTTG GGTACAACAA
GATTGCT