Os02t0757900-02

Locus

Os02g0757900

Description

Similar to Polyadenylate-binding protein 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PABN1

CGSNL Gene Name

POLY (A) BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsPABN1

Oryzabase Gene Name Synonym(s)

poly (A) binding protein 1

Transcript Evidence

AK071146 (DDBJ, Best hit)

Protein Evidence

B4FHB3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Nucleotide-binding, alpha-beta plait (IPR012677)

Full-length cDNA

J023081D16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0757900-02)

RiceXPro (AK071146)

Others

Oryzabase (22837)

KEGG (Os02t0757900-02)

Transcript

962 bp

>Os02t0757900-02 Similar to Polyadenylate-binding protein 2.
CGAGTCAGATTGGGGATCGACGAAGGTGGGGAGGGGCGAACGCCATGGACGAGGAGGAGC
ACGAGGTGTACGGGCAAGAGATCCCGGAGGACGGGGACATGGACGGCGCGGACGTCGACA
TGGCCTCCGGCGGGGACGACGCCGCGAAGCTGCAGGAGCTCGACCAGATGAAGCGAAGGC
TGAAGGAGATGGAGGAAGAGGCCGCGGCCCTCCGCGACATGCAGGCCAAGGTCGCCAAGG
AGATGCAAGGTGGTCCGCCGGGAGGAGATCCTAGCGCGTCTACAGCTGAGGCAAAGGAGC
AGGTGGATGCTCGATCTGTGTATGTTGGAAATGTTGATTATGCATGTACCCCAGAAGAAG
TGCAGCAGCATTTTCAAGCGTGTGGCACAGTCAATAGAGTGACGATCTTAACTGACAAGT
TTGGACAGCCAAAAGGTTTTGCTTATGTGGAATTTCTGGAACAAGAAGCAGTTCAGGAGG
CTCTGAATTTGAATGAATCTGAACTGCATGGTCGTCAGATAAAGGTGGCACCAAAGAGGA
CTAATGTCCCTGGGATGAAGCAGCGTCCACCGCGTGGATACAATCCTTATCATGGTTACC
CATATAGATCGTATGGGGCCCCATATTTCCCACCATATGGTTACGGGAGAGTCCCCAGAT
TCCGCCGTCCAATGCGCTACAGGCCATACTTTTGAAGTAAGAGGTTTTCATGACGTGGAA
CACAACACCAAGCCTAGTCGCTAGTCAGCCAAGTCGGTCCCAGAAATAATTCTACTATCT
GGTATTTTAGTTTCCCAGCAGACATGCTGGGTGAATGCTTCCACCCCCACCATATTCCAT
TTTGGTAACGTCCGCTCACTAGTTATCAGTATCTTGTATCGTTGGTTCTGCAGTACGCAA
AACGTAGTGTTATCTTATTATATTATATATACCTGCATCATATGATATTGGTTTGCCATA
CT

CDS

651 bp

>Os02t0757900-02 Similar to Polyadenylate-binding protein 2.
ATGGACGAGGAGGAGCACGAGGTGTACGGGCAAGAGATCCCGGAGGACGGGGACATGGAC
GGCGCGGACGTCGACATGGCCTCCGGCGGGGACGACGCCGCGAAGCTGCAGGAGCTCGAC
CAGATGAAGCGAAGGCTGAAGGAGATGGAGGAAGAGGCCGCGGCCCTCCGCGACATGCAG
GCCAAGGTCGCCAAGGAGATGCAAGGTGGTCCGCCGGGAGGAGATCCTAGCGCGTCTACA
GCTGAGGCAAAGGAGCAGGTGGATGCTCGATCTGTGTATGTTGGAAATGTTGATTATGCA
TGTACCCCAGAAGAAGTGCAGCAGCATTTTCAAGCGTGTGGCACAGTCAATAGAGTGACG
ATCTTAACTGACAAGTTTGGACAGCCAAAAGGTTTTGCTTATGTGGAATTTCTGGAACAA
GAAGCAGTTCAGGAGGCTCTGAATTTGAATGAATCTGAACTGCATGGTCGTCAGATAAAG
GTGGCACCAAAGAGGACTAATGTCCCTGGGATGAAGCAGCGTCCACCGCGTGGATACAAT
CCTTATCATGGTTACCCATATAGATCGTATGGGGCCCCATATTTCCCACCATATGGTTAC
GGGAGAGTCCCCAGATTCCGCCGTCCAATGCGCTACAGGCCATACTTTTGA

Protein

217 aa

>Os02t0757900-02 Similar to Polyadenylate-binding protein 2.
MDEEEHEVYGQEIPEDGDMDGADVDMASGGDDAAKLQELDQMKRRLKEMEEEAAALRDMQ
AKVAKEMQGGPPGGDPSASTAEAKEQVDARSVYVGNVDYACTPEEVQQHFQACGTVNRVT
ILTDKFGQPKGFAYVEFLEQEAVQEALNLNESELHGRQIKVAPKRTNVPGMKQRPPRGYN
PYHGYPYRSYGAPYFPPYGYGRVPRFRRPMRYRPYF*

5'UTR

chr02:31920523..31920566 (- strand) : 44 bp

CDS

chr02:31920418..31920522 (- strand) : 105 bp

chr02:31920215..31920326 (- strand) : 112 bp

chr02:31919196..31919266 (- strand) : 71 bp

chr02:31916835..31917026 (- strand) : 192 bp

chr02:31916603..31916724 (- strand) : 122 bp

chr02:31916472..31916520 (- strand) : 49 bp

3'UTR

chr02:31916205..31916471 (- strand) : 267 bp

FASTA

>Os02t0757900-02 class=Sequence position=chr02:31916205..31920566 (- strand)
CGAGTCAGAT TGGGGATCGA CGAAGGTGGG GAGGGGCGAA CGCCATGGAC GAGGAGGAGC ACGAGGTGTA CGGGCAAGAG
ATCCCGGAGG ACGGGGACAT GGACGGCGCG GACGTCGACA TGGCCTCCGG CGGGGACGAC GCCGCGAAGG TCTCCCTACC
TCCATGATCC GCGCATCTAT GGTCTATGAA CCTAACCCTA CTTCGAGTAG CTGACTACTA CCCCATTTGG CTTGTTGCAG
CTGCAGGAGC TCGACCAGAT GAAGCGAAGG CTGAAGGAGA TGGAGGAAGA GGCCGCGGCC CTCCGCGACA TGCAGGCCAA
GGTCGCCAAG GAGATGCAAG GTGGTCCGCC GGGTGTGCTC ACTGCCTGCC TAATTTTTAC TGATGCTTTT ATGTTTTTCT
TGTTGCGATC TGCTATGTTC ATATCGGCCT CATTCGATCT GTATTGTGAG GATCTACGTG TACCCTAGGT TAGATGACTA
TCTGATCAAG TTTAAAACTT ATTAAGGTCC CTCAATTTCG ACTAGGTTAA CTTGGTGAGG TTAGATCGAT CGGCCGTTAA
TTCGTGCCCT ACTCTGATAG TCTGATTTAG GAATTGGTAC TTCCGAGTTC CAAATATGTA TATTTGGGTT AACTTTTGCT
ACTTAACATT TCAACCACGA TCCAATCTGC TTGAATATAA GGTTTCGGAT TTCTTCATTT TTGTTGTTGA CTGTGCCCTT
ATATTTTGGG ATATACACAT ATTTTTACTT GTTAGTCCAT GTGGCTAGAA ATCTCAGTCT ACCCCTATAT TATCATTTGA
GTGTATATAT CTGGACAAGT CATGGAGGTT TTGGAttagg ggcctgttca ctttgatgcc aaaaaaaacc ttaccaaatt
ttggcattac caaaattttg gcaaactatg ccaaaatttt ggtaggattt cttatatagt tgccaaattt tggcagcaaa
ctaaatgtag cctttttttt tttgacaatt ttaccaaaat ttggtaaggt tgaaaatgac atcaaaatga acaggccctA
GGATTTACTT TGGTTTTGTC TTCAAATGAT TAGTATTATG GGCCTGCTTG CCCCGCTGCC TGCACCAGGT TCGCTGGCTG
CAGCAGCTAA GCAGCAGCAA GCTGTGAGGC AGCAATTCAC CCATAAAACA CTTCAAACAT CTATATCTGA ATGTGCCTTG
ACCCGATGTT CTATTTCCCA CATTTTCAGT TTTCTGATAG GTACTAGTTG GTAAGTTTCC ATTGCAACTT CTCTAATGCT
ATTACTCTTT TGTTTTGTAG GAGGAGATCC TAGCGCGTCT ACAGCTGAGG CAAAGGAGCA GGTGGATGCT CGATCTGTGT
ATGTTGGAAA TGTAAGAATT TATAAAGACC CATACTCTCT CTCACACACA CGTTTCATAT GATGGAAACT GTAAGctact
ccctcggtcc caaaaggaat ttcactctag gattcaaaat tcgtcgcaca aagattgtca ctctagggta ctacttgtcc
catcaatcac ctctcattca aatttctccc catactatcc ccaaccacac atcattatat aaggggtagt atagtctttt
ctcctcaaac cttaagtctc tgctaaacac cctagaatgt ctttcttttg ggatggaggg agTCCTATTT AGTTGCATTG
ATAACTACCA CATTTTTTAG CACTAAATGT GGAATACATG GATATATGTA CAGTGTAACA TATCATTAGA TATTTTCTGC
TGGTTCCTTG CTAGTTGAAA GATACCTTTG GTACATTTCA CTTAGATATG ACATACTTGT GCCAAATTAT ATAGCTCTCC
TAGCCCCCCC CCTTTCACCC CACCACATAC ACATCCAAAA ACAAATGCTT GTTTTGTTTT CTCGACTTCC CTTAAGCTCA
CCTAATAGCC TGCCTTATCT CCGAAAATTA GTTTACTTCT GCTTGTCTTA AATGTCAGAA GACATCATTA AAGCTATCAA
AAATTGGGTT TCTCTCTTCA TTTTAATCCA TGCTTAATAC TGTTCATTCG AACAACAAAA CATAAATTTC CATGCACAGT
TTTGTACTGT TGTTGTGATT TTTCCTCTGT GCTTATTGCC GTTCTGTTTC TAATGATAGT AGAAGATAGT ATCTTATATG
GCTATATGGT GAATATGCCT TGTTTTGGTG CATTGATTGA ATAATGGTGA TGGCCGCAGG GTAGTGCTGA GATCAAGCCT
TTCTCAAATC GAGTAATTGG CATCTGGTTG AACACCTGCC TGCATTTTAG TATTAGCTTA GAATTGAAAA AAAAAAGAGA
AATTCCCTGA AAAAAATAAA AAGAGCATGG GCAAAAAGGA AAAAAAAAAG AGCATGGGCA AAAGAAAAAG AAAAAAGGGA
AAAAAACAAA CATGAATATT CTAGGATAGG TTATCCTTGA AGGAGCAAAG GAAGTCTAGA AAGCAGCTGT ACACTCCTTG
GTGCTTGAGA CTCGAACCTG CATACGATGT GATGTGATTC TTAGCGACTG GTCCAATGAG AATCACCTGA ATACACATAG
GTATGACATA TAAGCCTAAT ATTAGGGAGC CTTCATATTA ACTTTATTCA TCTTTGTATC TCCATCTTTC CTTTTTTTTT
TACTTCTCTT GTGATGTCAA AGCACATCTT TCTATTTCTT TTGCCCCCTT TTCATTGACC ACCTTAATTA TTCTTGATGA
CATTGCTGAT GTGTCAGCAT AAATGTCAGT ATTGTTTTGT GGGGACTACA TTGAACTTTT CTTACAAGCA AGTAAAGGCT
ACCCAGTATT CTAGTAGCCC AAATGGGTGA CATCATGAAA ATTAACCTTT TGTTCAGTAA ATGCTATGGA AGTCAGTAAT
TTGTATGAAA ATTTAACAGC ACTTGCATAT GTTTAACAAA AATCCTTTTA ACTATGACAT TTATATTTTC CTGAAAGTCT
TGCCGTACAG ACTATACTGT ACGATAGTCC TAGAAATTGC ATCATCTATG CTAGTTTTTG CCTTGTTAGC ATGATATTGT
GCTTTTCTCT TCGCTTCAGA GTTCAGTATG TCTGGTCTCA TACTCCATTT GTCACATCAC GGGCACAATT ATATTATTTA
CAATTATGAT ATTCCTAGAT AATCAGTTAT ATGATGTTCC CCTTATAATG TTTCCAACTT TCGAAGTGGT AGTTACACCC
AAAGTGTCAT CTTGACTGGG TTTAGCCTGA AACACACTTT AAACATTGAT TTTTGTTGAC CTGAAATTTC CTCACCTGTG
TATCAACCAT GTGAAATTTT CAATTAGTAT CAGGCATGGC AATTTTGTAT TGTACCGAGG TATCTTATGT AGCACACTGA
AACCTTTAAA AGGCAGAAAT GGTTCTTTTG AGATTAACCG GTTAAAATCA GAATATTATC AAGGTGACTT GATAAGCATT
TTTTTAATTC TATTACCAGT CTGCAAGCAC ATCTGATTAT CTAATCTGAC ATGTACATTT AGTTTTCATT CATCTTAGTG
ATACAAATCA TTTACCGCAG GTTGATTATG CATGTACCCC AGAAGAAGTG CAGCAGCATT TTCAAGCGTG TGGCACAGTC
AATAGAGTGA CGATCTTAAC TGACAAGTTT GGACAGCCAA AAGGTTTTGC TTATGTGGAA TTTCTGGAAC AAGAAGCAGT
TCAGGAGGCT CTGAATTTGA ATGAATCTGA ACTGCATGGT CGTCAGATAA AGGTGCAGAA ATTACCAACA GATCCCTGTT
TTGTCACCTG AAGGATTCAA AAACTCCTTT TCACATGTTT TTGTCCTCGC AATTTACTCA ATTTCTGTTT TGTGCTCAAC
AGGTGGCACC AAAGAGGACT AATGTCCCTG GGATGAAGCA GCGTCCACCG CGTGGATACA ATCCTTATCA TGGTTACCCA
TATAGATCGT ATGGGGCCCC ATATTTCCCA CCATATGGTT ACGGGTAAGT TTAGCTTTTT TGACAACATG GATGTCTAAT
TCTTTATGTC TGGTGTCTAA CATCCATATT GTGTATTCTT GTTCAGGAGA GTCCCCAGAT TCCGCCGTCC AATGCGCTAC
AGGCCATACT TTTGAAGTAA GAGGTTTTCA TGACGTGGAA CACAACACCA AGCCTAGTCG CTAGTCAGCC AAGTCGGTCC
CAGAAATAAT TCTACTATCT GGTATTTTAG TTTCCCAGCA GACATGCTGG GTGAATGCTT CCACCCCCAC CATATTCCAT
TTTGGTAACG TCCGCTCACT AGTTATCAGT ATCTTGTATC GTTGGTTCTG CAGTACGCAA AACGTAGTGT TATCTTATTA
TATTATATAT ACCTGCATCA TATGATATTG GTTTGCCATA CT