Os02t0761100-01

Locus

Os02g0761100

Description

Similar to Cyclophilin-40 (Expressed protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP40B

CGSNL Gene Name

CYCLOPHILIN 40B

Oryzabase Gene Symbol Synonym(s)

OsCYP40b, OsCYP-8, OsCYP40-2

Oryzabase Gene Name Synonym(s)

cyclophilin 40b, cyclophilin 8

Transcript Evidence

AK070404 (DDBJ, Best hit)

Protein Evidence

NP_565381.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide TPR-1 (IPR001440)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Cyclophilin-like (IPR015891)

Tetratricopeptide repeat (IPR019734)

Elongated TPR repeat-containing domain (IPR023114)

Full-length cDNA

J023054M07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0761100-01)

RiceXPro (AK070404)

Others

Oryzabase (10071)

KEGG (Os02t0761100-01 (EC:5.2.1.8))

Transcript

1721 bp

>Os02t0761100-01 Similar to Cyclophilin-40 (Expressed protein).
AGTACACACAGGCGCCGTCCCGCAACGACACACACAGCCCACGAGGCCACGACTCTCTCC
CTCCCCCTCCCCCTCTCCCTCCTCTCGCCGTGAGCGGAACACGAGGCAACGCCGCCACCT
CGAGAAGCGCGTCGCCCTCTAGGGTTTTAGAGCAGCAGCGATGGAGGGCGGTGGGGAGGG
CACCACCACCGCCGCGGCGGCGGCGGCGGTGGCTGCGGGGAAGGAGGAGGAGGCGGAGGT
GGTGGTGGTGAGGAACCCGAGGTGCTACCTCGACGTGAGCATCGGCGGGGATATGGAGGG
GCGGATCGTGGTGGAGCTCTACGCCTCCGTGGCCCCTCGCACGGCGGAGAACTTCCGCGC
GCTCTGCACCGGCGAGAAGGGCGTCAGCGCCGCCACCGGCGTGCCGCTTCACTACAAGGG
TTCATGTATTCACCGGATTGTCAAAGGTTTTATGGTGCAAGGTGGGGATATTACCGCTGG
TGATGGAACTGGGGGAGAGTCAATATATGGATTGAATTTTGAGGATGAAAATTTTGTCCT
GAAGCATGAGAGAAAAGGGATGTTATCAATGGCTAATGCTGGTCCCGATACAAATGGATC
TCAGTTTTTCATCACTACAACCCGAACACCACACCTTGATGGGAAACATGTTGTTTTTGG
AAGGGTTATAAAAGGAATGGGGGTGGTTCGCTCAATGGAACATGTTTCTGTTGGAGAATC
TGACCGTCCAATTACTGATATTGTTATTGTTGATTGCGGAGAACTACCAGAAGGTGCCAG
TGATGGAGTTGTGAACTTTTTCAGTGATGGTGACATGTATCCTGATTGGCCAAATGATCT
CGAAGAAAAACCTGCAGAAATTTCTTGGTGGATGACTGCTGTTGACTCTGCAAAATCTTT
TGGAAATGAATATTTCAAGAAAAAAGATTACAAGACAGCCCTCAAAAAGTACAGAAAAGC
TATGAGATACTTAGATCTTTGCTGGGAGAAAGAAGAGATAGATGAAGAGAAGAGCTCAGC
ACTACGGAAGACAAAGTCAATTATACTCACAAATAGTTCTGCTTGCAAGCTGAAGTTGGG
AGATTTGAAAGGTGCTTTACTAGATGCAGACTTTGCATTGCGTGAAGGGGAGGGAAACCC
AAAAGCTTTTTTCCGTCAAGGACAGGCACGCATCGCACTCAATGATATTGATGCTGCAGT
TGAGAGCTTCAAGCATGCTCTGCAGTTGGAGCCAAACGATGGAGGAATTAAGCGGGAGCT
GGCTGCTGCAAAAAAGAAGATTGCTGACAGACGGGATCAGGAGCGGAAAGCATTTTCTAG
GATGTTCCAACCATCAGGAGGTTCAGAGAAGATCGATGAAGAGAATAACTGATCGGCTTA
AGTTCAACGTTTTGTAGTTCTCTTCATGACACATACTGGTGCTGCCTGGTGAAAAAATAG
AGTTCAGGTGATGGATGAGAGAGTTTTTGCATAACAGAAGGTGATGGATGAGAGAGTTAT
GCAGTTTTTGCATAACAGAAGGTGATGGATGAGAGAGTTTTTGCATAACAGAAACAACTC
CCATGGTTGAAAATAGTTTTGGTCTTTTGGACACCAAGCCTTATGTTTTGCAGTATAGAG
TTTGCCACAATGCTATCGTAGGAAATGTCTGGCGGATTGAATTGTCAAACTCTTGGAAAG
GCCTTTTGAATGACCAATCCTGTTAACGAAACATTGTTGGC

CDS

1212 bp

>Os02t0761100-01 Similar to Cyclophilin-40 (Expressed protein).
ATGGAGGGCGGTGGGGAGGGCACCACCACCGCCGCGGCGGCGGCGGCGGTGGCTGCGGGG
AAGGAGGAGGAGGCGGAGGTGGTGGTGGTGAGGAACCCGAGGTGCTACCTCGACGTGAGC
ATCGGCGGGGATATGGAGGGGCGGATCGTGGTGGAGCTCTACGCCTCCGTGGCCCCTCGC
ACGGCGGAGAACTTCCGCGCGCTCTGCACCGGCGAGAAGGGCGTCAGCGCCGCCACCGGC
GTGCCGCTTCACTACAAGGGTTCATGTATTCACCGGATTGTCAAAGGTTTTATGGTGCAA
GGTGGGGATATTACCGCTGGTGATGGAACTGGGGGAGAGTCAATATATGGATTGAATTTT
GAGGATGAAAATTTTGTCCTGAAGCATGAGAGAAAAGGGATGTTATCAATGGCTAATGCT
GGTCCCGATACAAATGGATCTCAGTTTTTCATCACTACAACCCGAACACCACACCTTGAT
GGGAAACATGTTGTTTTTGGAAGGGTTATAAAAGGAATGGGGGTGGTTCGCTCAATGGAA
CATGTTTCTGTTGGAGAATCTGACCGTCCAATTACTGATATTGTTATTGTTGATTGCGGA
GAACTACCAGAAGGTGCCAGTGATGGAGTTGTGAACTTTTTCAGTGATGGTGACATGTAT
CCTGATTGGCCAAATGATCTCGAAGAAAAACCTGCAGAAATTTCTTGGTGGATGACTGCT
GTTGACTCTGCAAAATCTTTTGGAAATGAATATTTCAAGAAAAAAGATTACAAGACAGCC
CTCAAAAAGTACAGAAAAGCTATGAGATACTTAGATCTTTGCTGGGAGAAAGAAGAGATA
GATGAAGAGAAGAGCTCAGCACTACGGAAGACAAAGTCAATTATACTCACAAATAGTTCT
GCTTGCAAGCTGAAGTTGGGAGATTTGAAAGGTGCTTTACTAGATGCAGACTTTGCATTG
CGTGAAGGGGAGGGAAACCCAAAAGCTTTTTTCCGTCAAGGACAGGCACGCATCGCACTC
AATGATATTGATGCTGCAGTTGAGAGCTTCAAGCATGCTCTGCAGTTGGAGCCAAACGAT
GGAGGAATTAAGCGGGAGCTGGCTGCTGCAAAAAAGAAGATTGCTGACAGACGGGATCAG
GAGCGGAAAGCATTTTCTAGGATGTTCCAACCATCAGGAGGTTCAGAGAAGATCGATGAA
GAGAATAACTGA

Protein

404 aa

>Os02t0761100-01 Similar to Cyclophilin-40 (Expressed protein).
MEGGGEGTTTAAAAAAVAAGKEEEAEVVVVRNPRCYLDVSIGGDMEGRIVVELYASVAPR
TAENFRALCTGEKGVSAATGVPLHYKGSCIHRIVKGFMVQGGDITAGDGTGGESIYGLNF
EDENFVLKHERKGMLSMANAGPDTNGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSME
HVSVGESDRPITDIVIVDCGELPEGASDGVVNFFSDGDMYPDWPNDLEEKPAEISWWMTA
VDSAKSFGNEYFKKKDYKTALKKYRKAMRYLDLCWEKEEIDEEKSSALRKTKSIILTNSS
ACKLKLGDLKGALLDADFALREGEGNPKAFFRQGQARIALNDIDAAVESFKHALQLEPND
GGIKRELAAAKKKIADRRDQERKAFSRMFQPSGGSEKIDEENN*

5'UTR

chr02:32047766..32047925 (+ strand) : 160 bp

CDS

chr02:32047926..32048183 (+ strand) : 258 bp

chr02:32049882..32050382 (+ strand) : 501 bp

chr02:32050555..32050642 (+ strand) : 88 bp

chr02:32050758..32050810 (+ strand) : 53 bp

chr02:32051006..32051110 (+ strand) : 105 bp

chr02:32051393..32051468 (+ strand) : 76 bp

chr02:32051545..32051582 (+ strand) : 38 bp

chr02:32051669..32051749 (+ strand) : 81 bp

chr02:32051860..32051871 (+ strand) : 12 bp

3'UTR

chr02:32051872..32051946 (+ strand) : 75 bp

chr02:32052027..32052300 (+ strand) : 274 bp

FASTA

>Os02t0761100-01 class=Sequence position=chr02:32047766..32052300 (+ strand)
AGTACACACA GGCGCCGTCC CGCAACGACA CACACAGCCC ACGAGGCCAC GACTCTCTCC CTCCCCCTCC CCCTCTCCCT
CCTCTCGCCG TGAGCGGAAC ACGAGGCAAC GCCGCCACCT CGAGAAGCGC GTCGCCCTCT AGGGTTTTAG AGCAGCAGCG
ATGGAGGGCG GTGGGGAGGG CACCACCACC GCCGCGGCGG CGGCGGCGGT GGCTGCGGGG AAGGAGGAGG AGGCGGAGGT
GGTGGTGGTG AGGAACCCGA GGTGCTACCT CGACGTGAGC ATCGGCGGGG ATATGGAGGG GCGGATCGTG GTGGAGCTCT
ACGCCTCCGT GGCCCCTCGC ACGGCGGAGA ACTTCCGCGC GCTCTGCACC GGCGAGAAGG GCGTCAGCGC CGCCACCGGC
GTGCCGCTTC ACTACAAGGT TTGTCCTGGT TTGGCGGTCC GTGTGCTACC CGTAGTTTTT CCTGGTTGCA GCCTTGGAGG
GTCGACGCGT GAGAGGATGC CGGCTGCGGT GCGATTGATC GTAGTTGGGG GGTGTTTAAG CTATCCGAGT TGGGGATTGT
GTGGTTTCGC AGATGAATTT GATGCTGTTT GCGTACTAGT GCGATTTCCA CCTGACGATT ATGATTTGGT TGTGCGCTCA
CAGAGGTTCG CATGATTCAG TAACTATCGC GTTCCATAGA TTTTTATTCA GTACCGCTGC CATTTTAACT TTGTTACTTA
GCGCAATTTC CGCACAAACC TCGCGGTGAA CATTTGCACA CTTGCAGCAC ATTTACTGCT GAGCAAGTTG ATCCCCAAAT
CCAACACAAA TCCGTTTGCA TGGTCCATTT GGTCGATGGA AATAGTATTT TCAGGTGTCT GCACGTTGCA ATTGGTTGTT
TCAGCTTTAG CTTTGATTTG TCCCCTTCTG TAACAACGCC ATTCCAAGTC CTCGCAGGCC TTTTGTTTTG ATTCGACAAC
TTTGCTTTCG CTGACATTGT TACGGTGTGT TCCTATTGTT AGTTCTCATG TTTGGCGCTA GTACTTTGTA TCGTTCCAGT
TAGTGTTAAC TGCTTTTAAT CCATATGGCT TATCTTTGCT TTAGTACTAG TGATAGTGAT GTGCTTCATG TGCCACTGCC
TACAACTGGT CCCGGTACTC AAATTATGGT CCTATGGCCC TCCTTTAGTT TTGACGTCAT CTCACTACTC ACTTGCATGG
TGGCCTACCT ACTTTCTTGT CTGATCTTAT GATGTACACG CTGAAACATA AAGCACCTTA GTTTTTTTTT TCTTTTCAAA
TTTGCATGCC TTTACTTTCT GTGGCTTTAT TGTTGGCAAT GTTACAATGT ACTACATATT CCTGAAATGC TTAAGCAGAG
CACTGCCATG TTTAGCCTGA AATGCGCACG CACACGCACA AGACTCTAAC TCTTTTGATA ATTTCGACCA TGTGCCAGGG
TTCAAAAAGT TGGACATGAT AAGAATACTT TCTTACAGTT ATGTCTGCAC TAGGTGGACA TGATACTATT CCGATTGTAG
ATTAGCCTTA AAGCAGCATC TGTCTGCACT AGGTGGACCA AGGTTTGTGT AGTATCTATT ATTTGGGAAG TAATCCAAGG
ACAAACTATA TGGCTGTAAG AGAATCATAT GCGGATCTGG TTCAATATGG TCAACATTTT TAAGTGAGGC TTGGTATTTA
AAAGCTAAGC TTAGGTTCTT TAGTCGTCAG TTGGAATGAT GATGGCAAGG AAACACTAAG TGCAGTAATA GTGACAAGTC
CTACTTGACT GTTGGGGGGG CGACAGGGAT CCAACTGCGT AATCTGTGGT TCTCTACTTT ATTTTGTAGT GGTGGGGACT
CTAGATGTTG GCTATCCTTC CACTTAACTG TTGTGGCTAT GATGCTAATT GGACAGAGTT AGCATCATTC TTAACCTTGA
AAGGTTACAA TGGCCATCCA TTCTTTGCTG AAAGAAAGAC CATGATTAGC CTTTGTTACA TTATTTCTTA ATGTTCACAA
TAGTTTTCCT TTCTTTTTTA CCATTGTGAA TCATCGGATC TTTAACTTCC AAAAAGGTTT TACTGACTGC GTCAACCAAT
CTTTTTTTTT TTCTTTTGGT GTTTTTACTC CTCCAGGGTT CATGTATTCA CCGGATTGTC AAAGGTTTTA TGGTGCAAGG
TGGGGATATT ACCGCTGGTG ATGGAACTGG GGGAGAGTCA ATATATGGAT TGAATTTTGA GGATGAAAAT TTTGTCCTGA
AGCATGAGAG AAAAGGGATG TTATCAATGG CTAATGCTGG TCCCGATACA AATGGATCTC AGTTTTTCAT CACTACAACC
CGAACACCAC ACCTTGATGG GAAACATGTT GTTTTTGGAA GGGTTATAAA AGGAATGGGG GTGGTTCGCT CAATGGAACA
TGTTTCTGTT GGAGAATCTG ACCGTCCAAT TACTGATATT GTTATTGTTG ATTGCGGAGA ACTACCAGAA GGTGCCAGTG
ATGGAGTTGT GAACTTTTTC AGTGATGGTG ACATGTATCC TGATTGGCCA AATGATCTCG AAGAAAAACC TGCAGAAATT
TCTTGGTGGA TGACTGCTGT TGACTCTGCA AAATCTTTTG GAAATGAATA TTTCAAGGTA TGCACTTCCT TTAGCATCCT
TTGGAAATTT TCTTTAGGTC ATATGAGGAA ATTCTCACTG CAGCATTATG TCTTGCATTG TTAGAATGTT AGTTGCATCA
TCGTATGTTA TATAGTACCG GATGATGCTC ATGTCCGGAG CTTGTAACTG AAGTTTCTTC ACTATGCAGA AAAAAGATTA
CAAGACAGCC CTCAAAAAGT ACAGAAAAGC TATGAGATAC TTAGATCTTT GCTGGGAGAA AGAAGAGATA GATGAAGGTA
GGTATTTTTT TTTCTTTTCC TATCAGTCTT CAATTTTGTT AATTTTATCA TTTGATACTT ATAGACCGAG GCATATCGTA
CTAGCTGATT CTAACAGCTT ATTGATGTGC AGAGAAGAGC TCAGCACTAC GGAAGACAAA GTCAATTATA CTCACAAATA
GTTCTGTAAG TCCCACAACT AACCACTTGT TGCATGACAA ATCATAATTC ACAAGTTTCT TCCCTTTCGT AATAAATATG
AGAAATTATA CTGATGAGAC ATTATTCATT AGTGCTTTCT GAATTGCATC TAATGTTATT ACATTTCCTG TAAATTTTAG
CCTCTGCTAT AAATATTGAA TCCACTTATG ACTTGTTCAG GCTTGCAAGC TGAAGTTGGG AGATTTGAAA GGTGCTTTAC
TAGATGCAGA CTTTGCATTG CGTGAAGGGG AGGGAAACCC AAAAGCTTTT TTCCGTCAAG GACAGGTTAG TGTTACACTG
TTACTGTTGG GTGTCATATT ACCTGAGATA GCAAAATCTT AATTTGTGGA GTTGTGCATG AGGCTGTGCT TAAAAAGCCA
CATTTGCATA CTTTTGTATG CATTAGCAAT GCAGCACTAC AATCTACATA TAATCCTGTT TTACTTGATA AAATATTATC
TGCAATTCTT GTTTTTGTTG TTGCTGGGAG GATTTGTTCT TAGTGCCTTC ATAGTGAGTT CAAATTTCCA GATTTAACGC
AGTTTAACAT GATACTGGGA TTTGCAGGCA CGCATCGCAC TCAATGATAT TGATGCTGCA GTTGAGAGCT TCAAGCATGC
TCTGCAGTTG GAGCCAAACG ATGGTTTGTC CCTTGCCCAC TCAATTGGCT ATTAAGTTTC TTCATTGGAA GTTTATATAT
TTTGTGTTCA TAAATCTAGG AGGAATTAAG CGGGAGCTGG CTGCTGCAAA AAAGAAGGTT AGTCCATTGA GTTCATGAAT
CTTTGGACTA ATGGATGTTC CTTCATTGAA GATGTTATTG ATCTGTCACC GACATTATCG CAGATTGCTG ACAGACGGGA
TCAGGAGCGG AAAGCATTTT CTAGGATGTT CCAACCATCA GGAGGTTCAG AGAAGATCGA TGAAGTACTC TTCTGATACC
ACATTCACCA TTTGGAATCT TTTGTTTGGA TCTTTGGCAT AACATCGGTA GAGGATGTGT CATTTGGATG ATAGTTTGTT
TTGTTTTTCT GCAGGAGAAT AACTGATCGG CTTAAGTTCA ACGTTTTGTA GTTCTCTTCA TGACACATAC TGGTGCTGCC
TGGTGAAAAA ATAGAGTTCA GGTTGCTCTT ACAGCCCACA GCCACTATTC CTTCGAAGTT TGTGTTGTTT CAATATACTG
ACTCCATTTT TATGCTTTCA GGTGATGGAT GAGAGAGTTT TTGCATAACA GAAGGTGATG GATGAGAGAG TTATGCAGTT
TTTGCATAAC AGAAGGTGAT GGATGAGAGA GTTTTTGCAT AACAGAAACA ACTCCCATGG TTGAAAATAG TTTTGGTCTT
TTGGACACCA AGCCTTATGT TTTGCAGTAT AGAGTTTGCC ACAATGCTAT CGTAGGAAAT GTCTGGCGGA TTGAATTGTC
AAACTCTTGG AAAGGCCTTT TGAATGACCA ATCCTGTTAA CGAAACATTG TTGGC

Locus: Os02g0761100

Loading...

Locus: Os02g0761100

Loading...