Os02t0762400-01

Locus

Os02g0762400

Description

CDK inhibitor (CKI), Seed development

RAP-DB Gene Symbol Synonym(s)

KRP1, OsiICK1, Orysa;KRP1, OrysaICK1, Orysa;ICK1, CDKI

RAP-DB Gene Name Synonym(s)

KIP-RELATED PROTEIN 1, Cyclin-dependent kinase inhibitor 1, KIP-related protein 1, inhibitor of cyclin-dependent kinase 1

CGSNL Gene Symbol

KRP1

CGSNL Gene Name

KIP-RELATED PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsiICK1, Orysa;KRP1, OrysaICK1, Orysa;ICK1, CDKI, OsICK1, ICK1

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 1, KIP-related protein 1, inhibitor of cyclin-dependent kinase 1

Transcript Evidence

DQ229362 (Belgium)

AK103084

Protein Evidence

Q6Z6G5

B7EU31

Literature

PMID: 17012406

Note

Manual Curation

November 30, 2009

Gene Ontology (GO)

Biological Process: cell cycle arrest (GO:0007050)

Molecular Function: cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Cyclin-dependent kinase inhibitor (IPR003175)

Full-length cDNA

J033118G18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0762400-01)

RiceXPro (AK103084)

Others

Oryzabase (7379)

KEGG (Os02t0762400-01)

Transcript

1265 bp

>Os02t0762400-01 CDK inhibitor (CKI), Seed development
agggaaacggccaaagaaggcgacggcggcggcgcaggaggggcgcgcacgcggcgcaga
tgggcaagtacatgaggaagttcaggggggccacgggggaggagttggccgccatggagg
tcacgcaggtggttggcgtccggacgaggtcgaggtcggcagcggcggcgggcgcgacga
cgacgaaggtgaaggcggcgtcggcggcgtccaccaggaggaggaaggcgctgctgccga
cggcgGTCGTGGGGACTACTCGCCGTGACGGCGGGAGCTGCTACCTCCAGCTGAGGAGCC
GCATGCTGTTCATGGCCCCGCCGAGGCCGGCGCCGGCCGCGAGGGCTCCGGTTGTAGCGG
AGGCGGCGGGTTCCGGGAACGGAGCGGCGGCGCATGCGGCGGCTGGCCTCTCGCGTTGCT
CCAGCACGGCGTCGTCCGTGGACGCGGCGGCTCAGGACAGGAGCCTCGCGTGCCGCTCCG
ACGTCGCGGAGGCAGGCAGCGAGCATGTCCCGGAGGGCTCCGCGAGCGACTCGGCGAGCG
GCCGTGACCGCGAGAGGAGAGAAACAACTCCATCAAGCTTTCTCCCCGGAGAGGTGAGCG
ATCTGGAGTCGGATCTGGCTGGAGGACAGAAGCGCAGCCGTCCACTACCTTCTGCGGCAA
CAGCCTCAGCACAGCAAGCCACGCGGCCGAAGATTCCGCCGGCCGCCGAGATCGAGGCGT
TCTTCGCGGCGGCCGAGGAGGCTGAGGCCAAGCGCTTCGCCGCCAAGTACAACTTCGACG
TCGTTCGCGGCGTGCCCCTCGACGCCGGTCGGTTCGAGTGGACTCCGGTGGTCAGCAGCC
GAAGCTGAAGCGAGCGTGCAGATTAAGCGGAAGCTAGAAAGGAAGGTACAGGGGGGCGCC
GTGTAGAAAGGGAAGGCGAGCTAGAGAGAGGAGAAGAAGAAGAAGAAAAGATGCTCATCC
AAAGGGAATAAACTGGAAAAGTGGGAGACTACAAAAAAAGAAGCATTATAGCCTAACAAC
CACCGATTCGACTCTTTTTTCTTTCACATTTTCTTTGCATTTTTACTCTTACTGTGTACT
AGAAAGTAGTAGCAGTAGTAAACTAGTAATTCGTCCCAGTATTTATCAGAGGTTTATCTC
GATAGGAATAGATATATTATCCCCTTACTGTAATTGCCTCCATCTTGTATTTGGATGGAA
ATTAAATTTACTGTACAGCAGCAGCAGCTGTTCTGCAAGTTTAAGTTAACCATCACCGTT
TTATT

CDS

789 bp

>Os02t0762400-01 CDK inhibitor (CKI), Seed development
atgggcaagtacatgaggaagttcaggggggccacgggggaggagttggccgccatggag
gtcacgcaggtggttggcgtccggacgaggtcgaggtcggcagcggcggcgggcgcgacg
acgacgaaggtgaaggcggcgtcggcggcgtccaccaggaggaggaaggcgctgctgccg
acggcgGTCGTGGGGACTACTCGCCGTGACGGCGGGAGCTGCTACCTCCAGCTGAGGAGC
CGCATGCTGTTCATGGCCCCGCCGAGGCCGGCGCCGGCCGCGAGGGCTCCGGTTGTAGCG
GAGGCGGCGGGTTCCGGGAACGGAGCGGCGGCGCATGCGGCGGCTGGCCTCTCGCGTTGC
TCCAGCACGGCGTCGTCCGTGGACGCGGCGGCTCAGGACAGGAGCCTCGCGTGCCGCTCC
GACGTCGCGGAGGCAGGCAGCGAGCATGTCCCGGAGGGCTCCGCGAGCGACTCGGCGAGC
GGCCGTGACCGCGAGAGGAGAGAAACAACTCCATCAAGCTTTCTCCCCGGAGAGGTGAGC
GATCTGGAGTCGGATCTGGCTGGAGGACAGAAGCGCAGCCGTCCACTACCTTCTGCGGCA
ACAGCCTCAGCACAGCAAGCCACGCGGCCGAAGATTCCGCCGGCCGCCGAGATCGAGGCG
TTCTTCGCGGCGGCCGAGGAGGCTGAGGCCAAGCGCTTCGCCGCCAAGTACAACTTCGAC
GTCGTTCGCGGCGTGCCCCTCGACGCCGGTCGGTTCGAGTGGACTCCGGTGGTCAGCAGC
CGAAGCTGA

Protein

263 aa

>Os02t0762400-01 CDK inhibitor (CKI), Seed development
MGKYMRKFRGATGEELAAMEVTQVVGVRTRSRSAAAAGATTTKVKAASAASTRRRKALLP
TAVVGTTRRDGGSCYLQLRSRMLFMAPPRPAPAARAPVVAEAAGSGNGAAAHAAAGLSRC
SSTASSVDAAAQDRSLACRSDVAEAGSEHVPEGSASDSASGRDRERRETTPSSFLPGEVS
DLESDLAGGQKRSRPLPSAATASAQQATRPKIPPAAEIEAFFAAAEEAEAKRFAAKYNFD
VVRGVPLDAGRFEWTPVVSSRS*

5'UTR

chr02:32111311..32111369 (+ strand) : 59 bp

CDS

chr02:32111370..32111801 (+ strand) : 432 bp

chr02:32111902..32111966 (+ strand) : 65 bp

chr02:32112072..32112281 (+ strand) : 210 bp

chr02:32112450..32112531 (+ strand) : 82 bp

3'UTR

chr02:32112532..32112948 (+ strand) : 417 bp

FASTA

>Os02t0762400-01 class=Sequence position=chr02:32111311..32112948 (+ strand)
agggaaacgg ccaaagaagg cgacggcggc ggcgcaggag gggcgcgcac gcggcgcaga tgggcaagta catgaggaag
ttcagggggg ccacggggga ggagttggcc gccatggagg tcacgcaggt ggttggcgtc cggacgaggt cgaggtcggc
agcggcggcg ggcgcgacga cgacgaaggt gaaggcggcg tcggcggcgt ccaccaggag gaggaaggcg ctgctgccga
cggcgGTCGT GGGGACTACT CGCCGTGACG GCGGGAGCTG CTACCTCCAG CTGAGGAGCC GCATGCTGTT CATGGCCCCG
CCGAGGCCGG CGCCGGCCGC GAGGGCTCCG GTTGTAGCGG AGGCGGCGGG TTCCGGGAAC GGAGCGGCGG CGCATGCGGC
GGCTGGCCTC TCGCGTTGCT CCAGCACGGC GTCGTCCGTG GACGCGGCGG CTCAGGACAG GAGCCTCGCG TGCCGCTCCG
ACGTCGCGGA GGTGAGGGAA TCGAAACCCT AGAATTCGAA TTCGAAAAAT GATCCCAGAT CTCTAATCAC CGGTTGCTGA
AGCGTGCGTG CTTTTTGGTG ATGTTCTACA GGCAGGCAGC GAGCATGTCC CGGAGGGCTC CGCGAGCGAC TCGGCGAGCG
GCCGTGACCG CGAGAGGTGG GAGAATTCTC CCTCATTTCC GGCAAATTCT TCTGAATTAT GCGTTCTGAC ATGCCCCTGA
CGCCGAATCA CCCTCGATTT TTCAAAATTT TCAAATTCCA GGAGAGAAAC AACTCCATCA AGCTTTCTCC CCGGAGAGGT
GAGCGATCTG GAGTCGGATC TGGCTGGAGG ACAGAAGCGC AGCCGTCCAC TACCTTCTGC GGCAACAGCC TCAGCACAGC
AAGCCACGCG GCCGAAGATT CCGCCGGCCG CCGAGATCGA GGCGTTCTTC GCGGCGGCCG AGGAGGCTGA GGCCAAGCGC
TTCGCCGCCA AGTAAGTATA TACAGAATTT TTACCGCTCG CTGTAACATC TAGTAAAAGT TACTGCGCGC CCTAGCTAGC
TTCGTTCTTC TTCTCCGATG CTCGCGCGTG GCGTGAATTT GCCGCTGCTG CCGGCGAGCA AGATAATTAA CGTGCGTGCG
CTTCTTCCCA TGGCCGCAGG TACAACTTCG ACGTCGTTCG CGGCGTGCCC CTCGACGCCG GTCGGTTCGA GTGGACTCCG
GTGGTCAGCA GCCGAAGCTG AAGCGAGCGT GCAGATTAAG CGGAAGCTAG AAAGGAAGGT ACAGGGGGGC GCCGTGTAGA
AAGGGAAGGC GAGCTAGAGA GAGGAGAAGA AGAAGAAGAA AAGATGCTCA TCCAAAGGGA ATAAACTGGA AAAGTGGGAG
ACTACAAAAA AAGAAGCATT ATAGCCTAAC AACCACCGAT TCGACTCTTT TTTCTTTCAC ATTTTCTTTG CATTTTTACT
CTTACTGTGT ACTAGAAAGT AGTAGCAGTA GTAAACTAGT AATTCGTCCC AGTATTTATC AGAGGTTTAT CTCGATAGGA
ATAGATATAT TATCCCCTTA CTGTAATTGC CTCCATCTTG TATTTGGATG GAAATTAAAT TTACTGTACA GCAGCAGCAG
CTGTTCTGCA AGTTTAAGTT AACCATCACC GTTTTATT

Locus: Os02g0762400

Loading...

Locus: Os02g0762400

Loading...