Os02t0763000-01

Locus

Os02g0763000

Description

FW2.2-like gene family protein, Regulation of grain width and weight

RAP-DB Gene Symbol Synonym(s)

OsCNR1, TGW2, OsFWL1

RAP-DB Gene Name Synonym(s)

Cell Number Regulator 1, FW2.2-like 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL1, FWL1, OsTGW2, OsCNR1, TGW2, CNR1

Oryzabase Gene Name Synonym(s)

FW2.2-like 1, CELL NUMBER REGULATOR 1

Transcript Evidence

AK241465

Protein Evidence

Q6Z6F9

Literature

PMID: 32167575

PMID: 23793979

Note

Manual Curation

March 16, 2020

Functional domain (InterPro)

PLAC8 motif-containing protein (IPR006461)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J065164J03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0763000-01)

Others

Oryzabase (13470)

KEGG (Os02t0763000-01)

Transcript

772 bp

>Os02t0763000-01 FW2.2-like gene family protein, Regulation of grain width and weight
GGTCTTGCCTTCCGCTTTAGCAGAGGCATAAACAAAGGTCTGTATTCCCAAGCAATGTAT
CCCTCCGCCCCTCCCGACGCGTATAACAAGTACAGCGCCGGTGCTCCACCGACGGCGCCG
CCGCCGGCAACGTACCAGCTGCCGACGATGAACACCCCACGCACCGGCGGCGGGCTGACG
CGATGGTCCACCGGCCTTTTCCACTGCATGGACGATCCCGGAAACTGTCTCATCACATGC
GTGTGCCCCTGCATCACCTTTGGGCAGGTCGCTGACATCGTGGACAAGGGCACCTGCCCA
TGCCTCGCGAGCGGGACGGCTTACGCGCTCCTCTGCGCGTCGGGGATGGGGTGCCTGTAC
TCGTGCTTCTACCGGTCCAAGATGAGGGCTCAGTTCGACCTGGACGAAGGGGATTGCCCC
GATTTCCTCGTCCATTTCTGCTGCGAGTACTGCGCGCTGTGCCAGGAGTACCGGGAGCTC
AAGAACCGCGGCTTCGACTTGGGGATCGGTTGGGCTGCCAATGTGGACAGGCAGAGGCGA
GGCGTCACCGGAGCGTCGGTGATGGGAGCTCCTGGCGTCCCGGTCGGCATGATGAGGTAG
ACGAAGATGGCGAACGCGAAATGGTGCGCTTTTGTGTTCTTGTGTTGCAATATGTTCTCT
GTGGTTTTCATTTGGAGATCACTGCCTATTTCATGTATCGTATACTCCTATTTAGCTTGA
TTTGTTGGGTTTCATGTAATATATGACGCATTCAGAAGTGTTGTGACTTGTC

CDS

546 bp

>Os02t0763000-01 FW2.2-like gene family protein, Regulation of grain width and weight
ATGTATCCCTCCGCCCCTCCCGACGCGTATAACAAGTACAGCGCCGGTGCTCCACCGACG
GCGCCGCCGCCGGCAACGTACCAGCTGCCGACGATGAACACCCCACGCACCGGCGGCGGG
CTGACGCGATGGTCCACCGGCCTTTTCCACTGCATGGACGATCCCGGAAACTGTCTCATC
ACATGCGTGTGCCCCTGCATCACCTTTGGGCAGGTCGCTGACATCGTGGACAAGGGCACC
TGCCCATGCCTCGCGAGCGGGACGGCTTACGCGCTCCTCTGCGCGTCGGGGATGGGGTGC
CTGTACTCGTGCTTCTACCGGTCCAAGATGAGGGCTCAGTTCGACCTGGACGAAGGGGAT
TGCCCCGATTTCCTCGTCCATTTCTGCTGCGAGTACTGCGCGCTGTGCCAGGAGTACCGG
GAGCTCAAGAACCGCGGCTTCGACTTGGGGATCGGTTGGGCTGCCAATGTGGACAGGCAG
AGGCGAGGCGTCACCGGAGCGTCGGTGATGGGAGCTCCTGGCGTCCCGGTCGGCATGATG
AGGTAG

Protein

182 aa

>Os02t0763000-01 FW2.2-like gene family protein, Regulation of grain width and weight
MYPSAPPDAYNKYSAGAPPTAPPPATYQLPTMNTPRTGGGLTRWSTGLFHCMDDPGNCLI
TCVCPCITFGQVADIVDKGTCPCLASGTAYALLCASGMGCLYSCFYRSKMRAQFDLDEGD
CPDFLVHFCCEYCALCQEYRELKNRGFDLGIGWAANVDRQRRGVTGASVMGAPGVPVGMM
R*

5'UTR

chr02:32155213..32155266 (+ strand) : 54 bp

CDS

chr02:32155267..32155438 (+ strand) : 172 bp

chr02:32155554..32155625 (+ strand) : 72 bp

chr02:32155728..32155937 (+ strand) : 210 bp

chr02:32156052..32156143 (+ strand) : 92 bp

3'UTR

chr02:32156144..32156315 (+ strand) : 172 bp

FASTA

>Os02t0763000-01 class=Sequence position=chr02:32155213..32156315 (+ strand)
GGTCTTGCCT TCCGCTTTAG CAGAGGCATA AACAAAGGTC TGTATTCCCA AGCAATGTAT CCCTCCGCCC CTCCCGACGC
GTATAACAAG TACAGCGCCG GTGCTCCACC GACGGCGCCG CCGCCGGCAA CGTACCAGCT GCCGACGATG AACACCCCAC
GCACCGGCGG CGGGCTGACG CGATGGTCCA CCGGCCTTTT CCACTGCATG GACGATCCCG GAAACTGTAA GTCCTTCAGT
CAGTCAGTTT TCCCACATGT TCTTCAGAGT TCAGAGTTCA GAGCAATAGA TGGTTGCCGG CCCATGGTTG CTCAATCACA
CCTGTCGTTT CTCTCATGCA GGTCTCATCA CATGCGTGTG CCCCTGCATC ACCTTTGGGC AGGTCGCTGA CATCGTGGAC
AAGGGCACCT GCCGTGAGTT CTCCCTTCTT CTCCTTCTTA CCAGCGAAAG ATTTTGGTCC ATTCACCAGC TTGTTCGTTG
ATTCGGTGCG TGTGAAACTG TGATCGATTT TGCAGCATGC CTCGCGAGCG GGACGGCTTA CGCGCTCCTC TGCGCGTCGG
GGATGGGGTG CCTGTACTCG TGCTTCTACC GGTCCAAGAT GAGGGCTCAG TTCGACCTGG ACGAAGGGGA TTGCCCCGAT
TTCCTCGTCC ATTTCTGCTG CGAGTACTGC GCGCTGTGCC AGGAGTACCG GGAGCTCAAG AACCGCGGCT TCGACTTGGG
GATCGGTAGG TGCAAGCACT GAAGCACAGT AGATTCTTCG CTTGCAAGCA AGAAATATCT TCTACTAGTA CTACTTTTTT
GAGGAGCACT CGAACTGACG AATAGTGTTT TCTGGTAAGG TTGGGCTGCC AATGTGGACA GGCAGAGGCG AGGCGTCACC
GGAGCGTCGG TGATGGGAGC TCCTGGCGTC CCGGTCGGCA TGATGAGGTA GACGAAGATG GCGAACGCGA AATGGTGCGC
TTTTGTGTTC TTGTGTTGCA ATATGTTCTC TGTGGTTTTC ATTTGGAGAT CACTGCCTAT TTCATGTATC GTATACTCCT
ATTTAGCTTG ATTTGTTGGG TTTCATGTAA TATATGACGC ATTCAGAAGT GTTGTGACTT GTC

Locus: Os02g0763000

Loading...

Locus: Os02g0763000

Loading...