Os02t0765600-01

Locus

Os02g0765600

Description

Alpha-amylase glycoprotein, Degradation of starch granule

RAP-DB Gene Symbol Synonym(s)

AMY1A, Amy1A/C*(RAmy1A/C), alpha Amy7, AMY1.1, Amy1A, RAmy1A/C, Amy1A/C*, Amy1, Amy1A_C, OsAmy1A, alphaAmy7-C, RAmy1A

RAP-DB Gene Name Synonym(s)

ALPHA-AMYLASE 1A, Alpha-amylase1A, Alpha-amylase-1A, Alpha-amylase isozyme 1B, Amylase-1

CGSNL Gene Symbol

AMY1A

CGSNL Gene Name

ALPHA-AMYLASE 1A

Oryzabase Gene Symbol Synonym(s)

Amy1A/C*(RAmy1A/C), alpha Amy7, AMY1.1, Amy1A, RAmy1A/C, Amy1A/C*, Amy1, Amy1A_C, OsAmy1A, alphaAmy7-C, RAmy1A, AmyI-1, OsAmyI-1

Oryzabase Gene Name Synonym(s)

Alpha-amylase1A, Alpha-amylase-1A, Alpha-amylase isozyme 1B, Amylase-1, alpha-amylase I-1

Transcript Evidence

M24286 (Genbank)

AK101744 (Genbank)

Protein Evidence

P17654 (UniProt)

Q0DXA4 (UniProt)

Literature

PMID: 29051768

PMID: 22967050

PMID: 19767453

Note

Manual Curation

June 4, 2019

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: alpha-amylase activity (GO:0004556)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 13 (IPR006046)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Glycosyl hydrolase, family 13, subfamily, catalytic domain (IPR006589)

Alpha-amylase, C-terminal beta-sheet (IPR012850)

Alpha-amylase, plant (IPR013775)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

J033061O03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0765600-01)

RiceXPro (AK101744)

Others

Oryzabase (8053)

KEGG (Os02t0765600-01 (EC:3.2.1.1))

Transcript

1560 bp

>Os02t0765600-01 Alpha-amylase glycoprotein, Degradation of starch granule
AATCATCCATCTCCGAAGTGTGTCTGCAGCATGCAGGTGCTGAACACCATGGTGAACAAA
CACTTCTTGTCCCTTTCGGTCCTCATCGTCCTCCTTGGCCTCTCCTCCAACTTGACAGCC
GGGCAAGTCCTGTTTCAGGGATTCAACTGGGAGTCGTGGAAGGAGAATGGCGGGTGGTAC
AACTTCCTGATGGGCAAGGTGGACGACATCGCCGCAGCCGGCATCACCCACGTCTGGCTC
CCTCCGCCGTCTCACTCTGTCGGCGAGCAAGGCTACATGCCTGGGCGGCTGTACGATCTG
GACGCGTCTAAGTACGGCAACGAGGCGCAGCTCAAGTCGCTGATCGAGGCGTTCCATGGC
AAGGGCGTCCAGGTGATCGCCGACATCGTCATCAACCACCGCACGGCGGAGCACAAGGAC
GGCCGCGGCATCTACTGCCTCTTCGAGGGCGGGACGCCCGACTCCCGCCTCGACTGGGGC
CCGCACATGATCTGCCGCGACGACCCCTACGGCGATGGCACCGGCAACCCGGACACCGGC
GCCGACTTCGCCGCCGCGCCGGACATCGACCACCTCAACAAGCGCGTCCAGCGGGAGCTC
ATTGGCTGGCTCGACTGGCTCAAGATGGACATCGGCTTCGACGCGTGGCGCCTCGACTTC
GCCAAGGGCTACTCCGCCGACATGGCAAAGATCTACATCGACGCCACCGAGCCGAGCTTC
GCCGTGGCCGAGATATGGACGTCCATGGCGAACGGCGGGGACGGCAAGCCGAACTACGAC
CAGAACGCGCACCGGCAGGAGCTGGTCAACTGGGTCGATCGTGTCGGCGGCGCCAACAGC
AACGCCACGGCGTTCGACTTCACCACCAAGGGCATCCTCAACGTCGCCGTGGAGGGCGAG
CTGTGGCGCCTCCGCGGCGAGGACGGCAAGGCGCCCGGCATGATCGGGTGGTGGCCGGCC
AAGGCGACGACCTTCGTCGACAACCACGACACCGGCTCGACGCAGCACCTGTGGCCGTTC
CCCTCCGACAAGGTCATGCAGGGCTACGCATACATCCTCACCCACCCCGGCAACCCATGC
ATCTTCTACGACCATTTCTTCGATTGGGGTCTCAAGGAGGAGATCGAGCGCCTGGTGTCA
ATCAGAAACCGGCAGGGGATCCACCCGGCGAGCGAGCTGCGCATCATGGAAGCTGACAGC
GATCTCTACCTCGCGGAGATCGATGGCAAGGTGATCACAAAGATTGGACCAAGATACGAC
GTCGAACACCTCATCCCCGAAGGCTTCCAGGTCGTCGCGCACGGTGATGGCTACGCAATC
TGGGAGAAAATCTGAGCGCACGATGACGAGACTCTCAGTTTAGCAGATTTAACCTGCGAT
TTTTACCCTGACCGGTATACGTATATACGTGCCGGCAACGAGCTGTATCCGATCCGAATT
ACGGATGCAATTGTCCACGAAGTACTTCCTCCGTAAATAAAGTGAGGATCAGGGACATAC
ATTTGTATGGTTTTACGAATAATGCTATGCAATAAAATTTGCACTGCTTAATGCTTATGC

CDS

1305 bp

>Os02t0765600-01 Alpha-amylase glycoprotein, Degradation of starch granule
ATGCAGGTGCTGAACACCATGGTGAACAAACACTTCTTGTCCCTTTCGGTCCTCATCGTC
CTCCTTGGCCTCTCCTCCAACTTGACAGCCGGGCAAGTCCTGTTTCAGGGATTCAACTGG
GAGTCGTGGAAGGAGAATGGCGGGTGGTACAACTTCCTGATGGGCAAGGTGGACGACATC
GCCGCAGCCGGCATCACCCACGTCTGGCTCCCTCCGCCGTCTCACTCTGTCGGCGAGCAA
GGCTACATGCCTGGGCGGCTGTACGATCTGGACGCGTCTAAGTACGGCAACGAGGCGCAG
CTCAAGTCGCTGATCGAGGCGTTCCATGGCAAGGGCGTCCAGGTGATCGCCGACATCGTC
ATCAACCACCGCACGGCGGAGCACAAGGACGGCCGCGGCATCTACTGCCTCTTCGAGGGC
GGGACGCCCGACTCCCGCCTCGACTGGGGCCCGCACATGATCTGCCGCGACGACCCCTAC
GGCGATGGCACCGGCAACCCGGACACCGGCGCCGACTTCGCCGCCGCGCCGGACATCGAC
CACCTCAACAAGCGCGTCCAGCGGGAGCTCATTGGCTGGCTCGACTGGCTCAAGATGGAC
ATCGGCTTCGACGCGTGGCGCCTCGACTTCGCCAAGGGCTACTCCGCCGACATGGCAAAG
ATCTACATCGACGCCACCGAGCCGAGCTTCGCCGTGGCCGAGATATGGACGTCCATGGCG
AACGGCGGGGACGGCAAGCCGAACTACGACCAGAACGCGCACCGGCAGGAGCTGGTCAAC
TGGGTCGATCGTGTCGGCGGCGCCAACAGCAACGCCACGGCGTTCGACTTCACCACCAAG
GGCATCCTCAACGTCGCCGTGGAGGGCGAGCTGTGGCGCCTCCGCGGCGAGGACGGCAAG
GCGCCCGGCATGATCGGGTGGTGGCCGGCCAAGGCGACGACCTTCGTCGACAACCACGAC
ACCGGCTCGACGCAGCACCTGTGGCCGTTCCCCTCCGACAAGGTCATGCAGGGCTACGCA
TACATCCTCACCCACCCCGGCAACCCATGCATCTTCTACGACCATTTCTTCGATTGGGGT
CTCAAGGAGGAGATCGAGCGCCTGGTGTCAATCAGAAACCGGCAGGGGATCCACCCGGCG
AGCGAGCTGCGCATCATGGAAGCTGACAGCGATCTCTACCTCGCGGAGATCGATGGCAAG
GTGATCACAAAGATTGGACCAAGATACGACGTCGAACACCTCATCCCCGAAGGCTTCCAG
GTCGTCGCGCACGGTGATGGCTACGCAATCTGGGAGAAAATCTGA

Protein

435 aa

>Os02t0765600-01 Alpha-amylase glycoprotein, Degradation of starch granule
MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWKENGGWYNFLMGKVDDI
AAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIV
INHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPYGDGTGNPDTGADFAAAPDID
HLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADMAKIYIDATEPSFAVAEIWTSMA
NGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFDFTTKGILNVAVEGELWRLRGEDGK
APGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWG
LKEEIERLVSIRNRQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQ
VVAHGDGYAIWEKI*

5'UTR

chr02:32250145..32250174 (- strand) : 30 bp

CDS

chr02:32250037..32250144 (- strand) : 108 bp

chr02:32249796..32249928 (- strand) : 133 bp

chr02:32248890..32249701 (- strand) : 812 bp

chr02:32248554..32248805 (- strand) : 252 bp

3'UTR

chr02:32248329..32248553 (- strand) : 225 bp

FASTA

>Os02t0765600-01 class=Sequence position=chr02:32248329..32250174 (- strand)
AATCATCCAT CTCCGAAGTG TGTCTGCAGC ATGCAGGTGC TGAACACCAT GGTGAACAAA CACTTCTTGT CCCTTTCGGT
CCTCATCGTC CTCCTTGGCC TCTCCTCCAA CTTGACAGCC GGGCAAGTCC TGTTTCAGGT AAGAGATCGC CATGAGTTGG
GTTTCAGGCT TCAGTGAACT GATCGGGTTT TGTACTGAGC CTAAGAGAAT GATGCAGTGA TGCTCTTGTG TTTGATGATG
ATGCAGGGAT TCAACTGGGA GTCGTGGAAG GAGAATGGCG GGTGGTACAA CTTCCTGATG GGCAAGGTGG ACGACATCGC
CGCAGCCGGC ATCACCCACG TCTGGCTCCC TCCGCCGTCT CACTCTGTCG GCGAGCAAGG TGCGGTGCTC TGCTCTCTCG
ATCCCCTCCG TCGTCGCACC ATTGCCGGCA AAATACATGC ACAGGTCGTT GAATTGCTTG AATGCTTCTG CAGGCTACAT
GCCTGGGCGG CTGTACGATC TGGACGCGTC TAAGTACGGC AACGAGGCGC AGCTCAAGTC GCTGATCGAG GCGTTCCATG
GCAAGGGCGT CCAGGTGATC GCCGACATCG TCATCAACCA CCGCACGGCG GAGCACAAGG ACGGCCGCGG CATCTACTGC
CTCTTCGAGG GCGGGACGCC CGACTCCCGC CTCGACTGGG GCCCGCACAT GATCTGCCGC GACGACCCCT ACGGCGATGG
CACCGGCAAC CCGGACACCG GCGCCGACTT CGCCGCCGCG CCGGACATCG ACCACCTCAA CAAGCGCGTC CAGCGGGAGC
TCATTGGCTG GCTCGACTGG CTCAAGATGG ACATCGGCTT CGACGCGTGG CGCCTCGACT TCGCCAAGGG CTACTCCGCC
GACATGGCAA AGATCTACAT CGACGCCACC GAGCCGAGCT TCGCCGTGGC CGAGATATGG ACGTCCATGG CGAACGGCGG
GGACGGCAAG CCGAACTACG ACCAGAACGC GCACCGGCAG GAGCTGGTCA ACTGGGTCGA TCGTGTCGGC GGCGCCAACA
GCAACGCCAC GGCGTTCGAC TTCACCACCA AGGGCATCCT CAACGTCGCC GTGGAGGGCG AGCTGTGGCG CCTCCGCGGC
GAGGACGGCA AGGCGCCCGG CATGATCGGG TGGTGGCCGG CCAAGGCGAC GACCTTCGTC GACAACCACG ACACCGGCTC
GACGCAGCAC CTGTGGCCGT TCCCCTCCGA CAAGGTCATG CAGGGCTACG CATACATCCT CACCCACCCC GGCAACCCAT
GCATCGTGAG TAGCCAACTC GATCAGAAAT TCTGAATCAT CCTGCAAACT GATCGATGAA CTGATGATAA ATTCTGTAAA
ATTGTTCAGT TCTACGACCA TTTCTTCGAT TGGGGTCTCA AGGAGGAGAT CGAGCGCCTG GTGTCAATCA GAAACCGGCA
GGGGATCCAC CCGGCGAGCG AGCTGCGCAT CATGGAAGCT GACAGCGATC TCTACCTCGC GGAGATCGAT GGCAAGGTGA
TCACAAAGAT TGGACCAAGA TACGACGTCG AACACCTCAT CCCCGAAGGC TTCCAGGTCG TCGCGCACGG TGATGGCTAC
GCAATCTGGG AGAAAATCTG AGCGCACGAT GACGAGACTC TCAGTTTAGC AGATTTAACC TGCGATTTTT ACCCTGACCG
GTATACGTAT ATACGTGCCG GCAACGAGCT GTATCCGATC CGAATTACGG ATGCAATTGT CCACGAAGTA CTTCCTCCGT
AAATAAAGTG AGGATCAGGG ACATACATTT GTATGGTTTT ACGAATAATG CTATGCAATA AAATTTGCAC TGCTTAATGC
TTATGC

Locus: Os02g0765600

Loading...

Locus: Os02g0765600

Loading...