Os02t0771400-00

Locus

Os02g0771400

Description

Protein-tyrosine phosphatase, SIW14-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPFA-DSP2, OsPP39

Oryzabase Gene Name Synonym(s)

plant and fungi atypical dual-specificity phosphatase 2, Protein phosphatase 39

Transcript Evidence

ab initio prediction

Protein Evidence

B6TUQ6 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: dephosphorylation (GO:0016311)

Molecular Function: protein tyrosine phosphatase activity (GO:0004725)

Molecular Function: phosphatase activity (GO:0016791)

Functional domain (InterPro)

Protein-tyrosine phosphatase, SIW14-like (IPR004861)

Protein-tyrosine phosphatase, active site (IPR016130)

Protein-tyrosine phosphatase, dual specificity phosphatase, eukaryotic (IPR020428)

Expression Databases

TENOR (Os02t0771400-00)

Others

Oryzabase (10260)

Transcript

615 bp

>Os02t0771400-00 Protein-tyrosine phosphatase, SIW14-like domain containing protein.
ATGCAGCTGGAGATTTCGCCGAGACAGAGGAGCCAGCAGCAGAAGGAGGAGGAAGGCGAG
CACCAGCAGCGCGCCGGCGAGGAGGCGGTGGGCGCCGTCTTCAGCATTGAGCCGTGGGTG
GACGCCGCGGCGGTGCTGGTGCCGCCGCTTAACTTCGCCGAGGTGAACGACGGCATCTTC
CGCTCCGGGTTCCCCGCCGCCGACAACTTCGCGTTCCTCCTCTCCCTCAAGCTACGCTCG
ATCGTGTACCTGTGCCCGGAGCCGTACCCGGAGGAGAACACGCGGTTTCTGGAGCAGAAC
GGCATCAAGCTTCACCAGTTCGGTATTGACGGCAGCAAGGAGCTGCTTGTAAACATCCCT
GAAGAAAAAATCCGAGAAGCACTCAAAGTTATTCTTGACGTAAGGAATCAACCGGTGCTC
ATCCACTGCAAGAGAGGCAAGCACCGGACTGGCTGCGTCGTTGGGTGCCTGAGAAAGTTG
CAGAAATGGTGCCTAACTTCAGTTTTCGACGAGTACCAGCATTTTGCAGCGGCGAAGGCG
AGAAGTACTGATCAGAGATTCATGGAGCTGTTTGACACATCCAGCTTGATGCACCTGACG
GCCTCACAGTGTTAA

CDS

615 bp

>Os02t0771400-00 Protein-tyrosine phosphatase, SIW14-like domain containing protein.
ATGCAGCTGGAGATTTCGCCGAGACAGAGGAGCCAGCAGCAGAAGGAGGAGGAAGGCGAG
CACCAGCAGCGCGCCGGCGAGGAGGCGGTGGGCGCCGTCTTCAGCATTGAGCCGTGGGTG
GACGCCGCGGCGGTGCTGGTGCCGCCGCTTAACTTCGCCGAGGTGAACGACGGCATCTTC
CGCTCCGGGTTCCCCGCCGCCGACAACTTCGCGTTCCTCCTCTCCCTCAAGCTACGCTCG
ATCGTGTACCTGTGCCCGGAGCCGTACCCGGAGGAGAACACGCGGTTTCTGGAGCAGAAC
GGCATCAAGCTTCACCAGTTCGGTATTGACGGCAGCAAGGAGCTGCTTGTAAACATCCCT
GAAGAAAAAATCCGAGAAGCACTCAAAGTTATTCTTGACGTAAGGAATCAACCGGTGCTC
ATCCACTGCAAGAGAGGCAAGCACCGGACTGGCTGCGTCGTTGGGTGCCTGAGAAAGTTG
CAGAAATGGTGCCTAACTTCAGTTTTCGACGAGTACCAGCATTTTGCAGCGGCGAAGGCG
AGAAGTACTGATCAGAGATTCATGGAGCTGTTTGACACATCCAGCTTGATGCACCTGACG
GCCTCACAGTGTTAA

Protein

205 aa

>Os02t0771400-00 Protein-tyrosine phosphatase, SIW14-like domain containing protein.
MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAAVLVPPLNFAEVNDGIF
RSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGIKLHQFGIDGSKELLVNIP
EEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKLQKWCLTSVFDEYQHFAAAKA
RSTDQRFMELFDTSSLMHLTASQC*

CDS

chr02:32541842..32542086 (- strand) : 245 bp

chr02:32541636..32541729 (- strand) : 94 bp

chr02:32538769..32538826 (- strand) : 58 bp

chr02:32538639..32538682 (- strand) : 44 bp

chr02:32538362..32538535 (- strand) : 174 bp

FASTA

>Os02t0771400-00 class=Sequence position=chr02:32538362..32542086 (- strand)
ATGCAGCTGG AGATTTCGCC GAGACAGAGG AGCCAGCAGC AGAAGGAGGA GGAAGGCGAG CACCAGCAGC GCGCCGGCGA
GGAGGCGGTG GGCGCCGTCT TCAGCATTGA GCCGTGGGTG GACGCCGCGG CGGTGCTGGT GCCGCCGCTT AACTTCGCCG
AGGTGAACGA CGGCATCTTC CGCTCCGGGT TCCCCGCCGC CGACAACTTC GCGTTCCTCC TCTCCCTCAA GCTACGCTCG
ATCGTGTGAG TCCTATACCT AGGATCTCTT TCTCGGCCAC GGCGACCGTG GCGGCGAGCT CGTCGATTAC GTGTTCTGAC
GGCGGCGGCG ACGCCTTGGC GTGGTTGATC GGTGCAGGTA CCTGTGCCCG GAGCCGTACC CGGAGGAGAA CACGCGGTTT
CTGGAGCAGA ACGGCATCAA GCTTCACCAG TTCGGTATTG ACGGCAGCAA GGTAAATGAA CAAGTCAAAA ATCATATGCG
TTGAGTCCTT TGATTTTCTG CTTTATTTTC CACGGATGGC AAAGTCGATC TTCGCATCGA ATTGTTTTTT GGTTTTTCGG
TCGATTTGGT GCGTTCTGCT TGTGGAGATA AATAATTTGC ACACATAATT TGCACCGAGA AATAGCAACT GGTATCGCAT
TACAGTGGAT GCGAGGGTTA CTTTAGGTAG AACGCGCTGT TTACCTGTTT GACATGAGCA CGCACTTGCG TTTTCTGCGC
GTTGCCTCGT GTCGTATGGC CATGAGCTCG TTCGACTACT TTCCGTTAAA AAAACATGGG AACTGACAAC TGATATTGCT
GCTTGCTTCG GCAAAACACT TGGGGGCAAC GCAACTAGGG CAAACAACAA CTCAACTAGA ACAAACAAAA GTCCCTTTCT
TGCTTTATCT TTGCCCCTTT CAGTTAGGGC ATTTGCTTGA GTCTTTCAGG CTGAAAATGT TTATCGTTTT TGGGTTTTGT
TAACCTAAAT TGACAAGGTT ACGTGGTGCA TGGTGACTAT AAAACACCCT GTTTGAGCAA AATGCATCTA GTGCGCTACT
ATTTTTATGT TCTTATTTCA CTAATTCGTT TTCCCTTCTC ACAAAATAGT GTAGAAAATC TCATTATGGT AGGAGTTATT
TTTTTTACAA TGCAAAACAA CAGTGTCAGT TAAGCGGGTT CTTGCGTCAG CCCAGCACCC ATAGAAGATT AGAAGTTGTT
TACAATGCTG CAAAAGCGTA TCTTGCTACT GGCCTACTGC CATTAGCAAC AGTAAAGCTT ATCTTTGTTA TGATTATTCT
GGTAGCGTTG TGCTACTTTT CTAGAAGCTA GTTCAAACTG ATTGGTAGAC TCATGGCTAA GGAAAATATT TTCTATTTCA
GCATCACGCA TTTCAGGGTT AGGAGATTTT TGTCTGCATT ATGCCAGTCT GGTTCTGAGT TTTACTGAAT ACTGCAAGCT
TTAAGGGTAA AAAAAAAAAA AGAAAACACC TTAAGCTTAA GTGATCAGTG ATGCAGTACA GCACAAGTTC TACTCCCTCT
ATCAAAAAAA AAACTAATCC TAAATTTGAA TCTAGAAAGA CGGAGGGAGT AGCTGAGAAA TGATGGGCTT GTGGAGTCTC
CTCTGTGAAT TGGGTGCCTA AACAAAGATC AAGTTGACTT ATGCCCATTA TTTTTTTTAA GAGAACTTAT GTGAAAAAAA
AAGAGGATCA AGTTGACTTA TAGTATAATC GCACCTGTCT TTTAACTGTC GAGTGACGTC TGACCAGCGT AATTCTTTCA
TAAATTTGTT GGCCATGACT TTAATTCCGT TATTAACCAG CCACCCAAGA TTACCATTTC TCTGTGTGCC ATGCCATATT
TATTCTCATT TTACTAGTCC TTCACTGAAA GCCATTAGTA CGGTTTTGTC AAGCTGTCCA TATTAAAAGT TCATTTAGGC
ATAGACGCAT AGTAGCCTTG GAGTATGTCG GTATATTACT CCATCTCGCA ACTTTAGTAC TCGTGTCATC GCGTGGTAGC
ATCCACCGCA AGTCTGCAAC AATGAGAACA TATTCCACTG TCAGTTCTGG GTTCATGAAG GCATGAACTG CCACGGCAAA
TGGTCAAAGT TGGTCAGCGT CGGCGACTTa aggctgaggt cgttgcttgg gttaggtatt catccctagt tcatgcaaaa
tgacataact cattaacgta tgattaatta agttttagtt tttttaaaaa aataaaatta atatgaatat aaaatttaaa
ttaactttca tatagatttc atatagattt ttgttaaaaa aaacaccgtt cagtaattaa aaaaatgtgc atgtgaaaat
cgagtgagtt aagttggGAC CTTCAAACAA AAAAAAACTT TCATCGTTCA TTGGCGATTG TTGCTGTCGA TGATAAACAA
CACAGATGTG CTGACCAACT TTAGCATTCC CAGCAAAAAA GAAATATATC GCTGAGTGAA AAGACACTGA TCAGGTGGCT
GACCTTACTA CAAGTGTGTG AATGGAAATT AGTGCTCACT TTGACATTGT CTGGAGATGA TGCTTCTTTT TCGCCGGACT
CAAGCTAGGT GTCTGAAACC ACTGAATTAC GAGGGTCACC GGTAATAATT GTGTCACTGC TAGATGGATT CTAGGATGGT
CACTGCTAGA TGGATTGTAC GGTGgtgttt ggatcaagga ctaaacttta gctcctgtca tatcggatga atttagagta
ttaaacatag actacttata aaactaatta cataaatgag agctaattcg cgtgacaaaa tttttaagcc taattaatcc
ataattagcg catgtttact gtagcatcac ataggctaat tatgaattaa ttaggtttaa tagattcgtc tcgcgaatta
gtccggggtc atataatagg ttttattaat agtctatgtt taatatttat aattagtgtc caaacatacg atgtgatatg
gactaaaaag ttttagtccc atctaaacag ggtctAAGCT TGTTTCTTTG TTAACTAGAA CCAATAATGT AGTACATACT
TGAGTGGCAT GACGATATCT TTGCATCTGA ACTTTCGATA AAGGTGAACC TTATCAGTTA CCGCATTAGC CTGAAACTGT
GAAACAAATT AAAACATCCT TCTATTGCTA TACCATATCA TCAGTAATTC AGTATGCATC CAACTGACCA TTCTCTTCAA
TCCTGTTGAC TCTTAAAGTT GATGCATAGC CTGACAATAA TCTGAACCTT GCTGTTACAG GAGCTGCTTG TAAACATCCC
TGAAGAAAAA ATCCGAGAAG CACTCAAAGT TATTCTTGGT ATCTGCCTCT ACAAAGATAT ATCCAATGTC TCAAAATTTC
ATCACACTAT CTGTATCTAA CTCTTATCGT TTTGATCAAT TCAGACGTAA GGAATCAACC GGTGCTCATC CACTGCAAGA
GAGGCAAGGT AGCTATATCT ATTTAGCATT GCACATCCCT GATATCCCAT TTTCTTGAAA CCTTTTGCTA CATGGGAATT
CGACGGTTTC CTGATATTCC ACATGTTTCA GCACCGGACT GGCTGCGTCG TTGGGTGCCT GAGAAAGTTG CAGAAATGGT
GCCTAACTTC AGTTTTCGAC GAGTACCAGC ATTTTGCAGC GGCGAAGGCG AGAAGTACTG ATCAGAGATT CATGGAGCTG
TTTGACACAT CCAGCTTGAT GCACCTGACG GCCTCACAGT GTTAA

Locus: Os02g0771400

Loading...

Locus: Os02g0771400

Loading...