Os02t0771600-01

Locus

Os02g0771600

Description

Similar to 1-aminocyclopropane-1-carboxylate oxidase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACO3

CGSNL Gene Name

AMINOCYCLOPROPANE-1-CARBOXYLIC ACID OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsACO3, ACO2, OsACO2

Oryzabase Gene Name Synonym(s)

ACC oxidase 3

Transcript Evidence

AK066805 (DDBJ, Best hit)

Protein Evidence

O65031 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Full-length cDNA

J013078A14 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0771600-01)

RiceXPro (AK066805)

Others

Oryzabase (9073)

KEGG (Os02t0771600-01)

Transcript

2999 bp

>Os02t0771600-01 Similar to 1-aminocyclopropane-1-carboxylate oxidase (Fragment).
ACACTTCGCCGGGGCTCCACATCTCCTCTCCTCCCACAGTCGGCGGTCCTGCCTCTCCCC
ATCCGGCGGCCTCGAGCTTGAGCTCCTCTTCCTCTTCTCTCCTCCGATGGCTGGCGGCCT
CACCTCTCCCCCCATCCGGCGGTCCTCTCCTCGGTGGAGCCTCGAATCGGACAACGTCGA
CCAGATCGACACGACAAGGAGGTTGAGGCAGATGTGGATCGAGGCGGCCTTCGTCGGGCC
ACCACTGCGGACGGGTCGAGGTGGCCGTCGTCGAGCTGCTACTGCACAGGTTGACAACGA
CGATGAGCGACGGCTTGTAAATACATAGTACAATATGTACATGAGCAATCCAGGAGGCGA
CTCCACCAGGTCTGAACCACCTTCCTAGCTCACCACCTTGCCACCATCGGCAACGTCACC
CACCCACTTCCGATGCCTGCCCTCTCCTCTCCTCTCACATTCTTTTTCTTTCTCTCTCTG
CCTAATACAGATATTTTTCTTCTATGAATTCAATTCATATTTTCTCGATCCATAAACACT
GACGGCAAGAGCGAGCCATCACAGACGACACTCTTGCTCCATGTGGGCATCGGTTGGTGC
CTAGAGAGCTGATTTGATAGGATGAGGTTGGTCGGTTTGTTTTGAACGTGGACTAATCAA
CGTGAAGCAGGGAAGCCTTTAGAGGAGGTTGGCTTGTTCGGTTTAGTAGGTGGTTATAGA
GGTGGTATTGGCCGGACACAATGTACGGTTTTTTCCTAACAAACTAAGCACTGTATGTTT
TTTTTGCATAATGTATGGTTTGATATTTTTTTTCTTAAAATGTTATATCTTCTTTAATAT
AATAAATTGCCACACCCTTTTTAAAAAACCTGATATGTGTCCATAGGACCTAGCCATGTG
AAGTCTACATTTGACAAATCAAATTGATCAGGTCTGGGCCAGGTGTACTATGCCCAAAAT
TCTGTCATCATCAAATCCAAAAAGCAAGGAACAGTCTCTTATCGATCTGTAGTTCTCTAC
TTAATAGAGTTGATCACTTAGGTTAGGTATATAGAATAGTAACCACCACTACCATTATAG
TATTACACTATAGTACTACTACATCACAAAGGCATTAGACATTAATTAGGAGTAAGAGCA
AATCTTGTGGAGAACCTTTTTGTGACTGTGTCGGGTAACCGGCATGAACTCAACCTGCGG
CGTGCACAGGACACAGTGTGATCAGATCAGATAATCAGATTAGCAGCTTAGCTTAGCTTA
GCTTGCTTACGTCCACACTACTTTACTCTCCGTTGGACCAAATCACTAAACTTTGTCGTA
AACTCGtactacctccgtgccataataagtgtagccataagtttccgcgtccaactttga
tcgtccgtcttatttgaaacttttttataattagtatttttgttgttatgagatgataaa
acatgaatagtactttactcgtgacttatgtttttaatttttttaaaaaaattttcaaat
aagacgaacggttaaagttagatgcggaaaaccatggctgcacttattttgagatgtagg
aagtaAGGCATACCGCACACCACGTCCTGGGGGTCAGGCAGTCAGCCTAGTGAAAAAGAT
AACTGTGCAAGCTAGCTTCTCGCTCTCGCGCCTATAAATTGGGCGCTCGCCGCCGGCCTC
AGAGTGCACACACAGACACACAGACGCACTCACACACTCAGCTTAAGCGAGCGAGCGAGT
GAACGAGAGAGAGAGACAGAGATGGCGAGTGTTGCCTCCTTCCCGGTGATCAACATGGAG
AACCTGGAGACCGAGGAGAGGGGCGCAGCAATGGAGGTCATCCGCGACGCCTGCGAGAAC
TGGGGCTTCTTCGAGATGCTGAACCATGGCATCGCGCACGAGCTGATGGACGAGGTGGAG
CGGGTGAGCAAGGCGCACTACGCCAACTGCCGGGAGGAGAAGTTCAAGGAGTTCGCGCGG
CGGATGCTGGAGGCCGGCGAGAAGGGCGCCGACGTGAAGGGCATCGACTGGGAGAGCACC
TTCTTCGTCCGCCACCGCCCCGTCTCCAACCTCGCCGACCTCCCCGACGTCGACGACCAC
TACAGGCAGGTGATGAAGCAATTTGCGTCGGAGATCGAGAAGCTCTCGGAGAGGGTGCTG
GACCTGCTGTGCGAGAATCTGGGCCTGGAGAAGGGTTACCTGAAGAAGGCCTTCGCCGGG
TCGAACGGCCCAACGTTCGGCACCAAGGTGAGCAGCTACCCGCCGTGCCCGCGCCCCGAT
CTCGTCGACGGCCTCCGCGCCCACACCGACGCCGGTGGCATCATCCTGCTGTTCCAGGAC
GACCAGGTGAGCGGCCTCCAGCTGCTCAAGGACGGGGAGTGGGTGGACGTGCCGCCCATG
CGCCACGCCATCGTCGCCAACATCGGCGACCAGCTGGAGGTGATCACCAACGGCAGGTAC
AAGAGCGTCATGCACCGCGTCCTCACGCGCCCCGACGGCAACCGCATGTCCATCGCCTCC
TTCTACAACCCCGGCGCCGACGCCGTCATCTTCCCGGCGCCCGCGCTCGCCGCCGCCGAC
GCGGCGGCGGCCGCCTACCCGAGGTTCGTGTTCGAGGACTACATGAACCTGTACGTGCGC
CACAAGTTCGAGGCCAAGGAGCCACGCTTCGAGGCCATGAAGTCCGCCGCCGAGGTCGTC
CACGCGGCGCCCATCGCCACCGCTTGATAAGGATCAGACTTCACTAGCTACGGCTGCGCG
TGCCATGATCCAGATATATGGGATGTGTACGGTAGTGTACGTGGTGCTGTACATGCCGTC
CCGTGTTTTTCTGCGTAATGTTTTTACGTACTAGACTACTACTAGTGTGTGTACGTAACC
TGGGGATGTAAGTATCGCGTCAAGTACTCAAGTGTGTGTAACGGGCGCTCTAATCGTATT
GTTCTGTGCTTCAATGGCTACCACGTTAGATGGGCCTTGTGCTAATGTTGTTTTATGCT

CDS

966 bp

>Os02t0771600-01 Similar to 1-aminocyclopropane-1-carboxylate oxidase (Fragment).
ATGGCGAGTGTTGCCTCCTTCCCGGTGATCAACATGGAGAACCTGGAGACCGAGGAGAGG
GGCGCAGCAATGGAGGTCATCCGCGACGCCTGCGAGAACTGGGGCTTCTTCGAGATGCTG
AACCATGGCATCGCGCACGAGCTGATGGACGAGGTGGAGCGGGTGAGCAAGGCGCACTAC
GCCAACTGCCGGGAGGAGAAGTTCAAGGAGTTCGCGCGGCGGATGCTGGAGGCCGGCGAG
AAGGGCGCCGACGTGAAGGGCATCGACTGGGAGAGCACCTTCTTCGTCCGCCACCGCCCC
GTCTCCAACCTCGCCGACCTCCCCGACGTCGACGACCACTACAGGCAGGTGATGAAGCAA
TTTGCGTCGGAGATCGAGAAGCTCTCGGAGAGGGTGCTGGACCTGCTGTGCGAGAATCTG
GGCCTGGAGAAGGGTTACCTGAAGAAGGCCTTCGCCGGGTCGAACGGCCCAACGTTCGGC
ACCAAGGTGAGCAGCTACCCGCCGTGCCCGCGCCCCGATCTCGTCGACGGCCTCCGCGCC
CACACCGACGCCGGTGGCATCATCCTGCTGTTCCAGGACGACCAGGTGAGCGGCCTCCAG
CTGCTCAAGGACGGGGAGTGGGTGGACGTGCCGCCCATGCGCCACGCCATCGTCGCCAAC
ATCGGCGACCAGCTGGAGGTGATCACCAACGGCAGGTACAAGAGCGTCATGCACCGCGTC
CTCACGCGCCCCGACGGCAACCGCATGTCCATCGCCTCCTTCTACAACCCCGGCGCCGAC
GCCGTCATCTTCCCGGCGCCCGCGCTCGCCGCCGCCGACGCGGCGGCGGCCGCCTACCCG
AGGTTCGTGTTCGAGGACTACATGAACCTGTACGTGCGCCACAAGTTCGAGGCCAAGGAG
CCACGCTTCGAGGCCATGAAGTCCGCCGCCGAGGTCGTCCACGCGGCGCCCATCGCCACC
GCTTGA

Protein

321 aa

>Os02t0771600-01 Similar to 1-aminocyclopropane-1-carboxylate oxidase (Fragment).
MASVASFPVINMENLETEERGAAMEVIRDACENWGFFEMLNHGIAHELMDEVERVSKAHY
ANCREEKFKEFARRMLEAGEKGADVKGIDWESTFFVRHRPVSNLADLPDVDDHYRQVMKQ
FASEIEKLSERVLDLLCENLGLEKGYLKKAFAGSNGPTFGTKVSSYPPCPRPDLVDGLRA
HTDAGGIILLFQDDQVSGLQLLKDGEWVDVPPMRHAIVANIGDQLEVITNGRYKSVMHRV
LTRPDGNRMSIASFYNPGADAVIFPAPALAAADAAAAAYPRFVFEDYMNLYVRHKFEAKE
PRFEAMKSAAEVVHAAPIATA*

5'UTR

chr02:32558636..32560396 (+ strand) : 1761 bp

CDS

chr02:32560397..32560510 (+ strand) : 114 bp

chr02:32560832..32561061 (+ strand) : 230 bp

chr02:32561654..32562275 (+ strand) : 622 bp

3'UTR

chr02:32562276..32562547 (+ strand) : 272 bp

FASTA

>Os02t0771600-01 class=Sequence position=chr02:32558636..32562547 (+ strand)
ACACTTCGCC GGGGCTCCAC ATCTCCTCTC CTCCCACAGT CGGCGGTCCT GCCTCTCCCC ATCCGGCGGC CTCGAGCTTG
AGCTCCTCTT CCTCTTCTCT CCTCCGATGG CTGGCGGCCT CACCTCTCCC CCCATCCGGC GGTCCTCTCC TCGGTGGAGC
CTCGAATCGG ACAACGTCGA CCAGATCGAC ACGACAAGGA GGTTGAGGCA GATGTGGATC GAGGCGGCCT TCGTCGGGCC
ACCACTGCGG ACGGGTCGAG GTGGCCGTCG TCGAGCTGCT ACTGCACAGG TTGACAACGA CGATGAGCGA CGGCTTGTAA
ATACATAGTA CAATATGTAC ATGAGCAATC CAGGAGGCGA CTCCACCAGG TCTGAACCAC CTTCCTAGCT CACCACCTTG
CCACCATCGG CAACGTCACC CACCCACTTC CGATGCCTGC CCTCTCCTCT CCTCTCACAT TCTTTTTCTT TCTCTCTCTG
CCTAATACAG ATATTTTTCT TCTATGAATT CAATTCATAT TTTCTCGATC CATAAACACT GACGGCAAGA GCGAGCCATC
ACAGACGACA CTCTTGCTCC ATGTGGGCAT CGGTTGGTGC CTAGAGAGCT GATTTGATAG GATGAGGTTG GTCGGTTTGT
TTTGAACGTG GACTAATCAA CGTGAAGCAG GGAAGCCTTT AGAGGAGGTT GGCTTGTTCG GTTTAGTAGG TGGTTATAGA
GGTGGTATTG GCCGGACACA ATGTACGGTT TTTTCCTAAC AAACTAAGCA CTGTATGTTT TTTTTGCATA ATGTATGGTT
TGATATTTTT TTTCTTAAAA TGTTATATCT TCTTTAATAT AATAAATTGC CACACCCTTT TTAAAAAACC TGATATGTGT
CCATAGGACC TAGCCATGTG AAGTCTACAT TTGACAAATC AAATTGATCA GGTCTGGGCC AGGTGTACTA TGCCCAAAAT
TCTGTCATCA TCAAATCCAA AAAGCAAGGA ACAGTCTCTT ATCGATCTGT AGTTCTCTAC TTAATAGAGT TGATCACTTA
GGTTAGGTAT ATAGAATAGT AACCACCACT ACCATTATAG TATTACACTA TAGTACTACT ACATCACAAA GGCATTAGAC
ATTAATTAGG AGTAAGAGCA AATCTTGTGG AGAACCTTTT TGTGACTGTG TCGGGTAACC GGCATGAACT CAACCTGCGG
CGTGCACAGG ACACAGTGTG ATCAGATCAG ATAATCAGAT TAGCAGCTTA GCTTAGCTTA GCTTGCTTAC GTCCACACTA
CTTTACTCTC CGTTGGACCA AATCACTAAA CTTTGTCGTA AACTCGtact acctccgtgc cataataagt gtagccataa
gtttccgcgt ccaactttga tcgtccgtct tatttgaaac ttttttataa ttagtatttt tgttgttatg agatgataaa
acatgaatag tactttactc gtgacttatg tttttaattt ttttaaaaaa attttcaaat aagacgaacg gttaaagtta
gatgcggaaa accatggctg cacttatttt gagatgtagg aagtaAGGCA TACCGCACAC CACGTCCTGG GGGTCAGGCA
GTCAGCCTAG TGAAAAAGAT AACTGTGCAA GCTAGCTTCT CGCTCTCGCG CCTATAAATT GGGCGCTCGC CGCCGGCCTC
AGAGTGCACA CACAGACACA CAGACGCACT CACACACTCA GCTTAAGCGA GCGAGCGAGT GAACGAGAGA GAGAGACAGA
GATGGCGAGT GTTGCCTCCT TCCCGGTGAT CAACATGGAG AACCTGGAGA CCGAGGAGAG GGGCGCAGCA ATGGAGGTCA
TCCGCGACGC CTGCGAGAAC TGGGGCTTCT TCGAGGTGCA TATGCATGCC AAGCACTAGC ATGTACTAAC CAGCAAAAAA
ATGTTAATAT GATTCTAGCT AATTCCTAAG TGGCCGCACA ACTTATTGAT ATGTTTCGAT TTTTTTTTGT TCATCGAGCC
ACCTATACGT ACATCGTTCT TTCTGGCCGA AAGGATGGAA ACATATTCTT ATTCTCCATC TTAGTCAGTC GACCCACCAA
TTCAATCTTA TCATCTCAGT AGGCTCGCCG GCTAGAACGC CTACTAATTA GCTTTGATTT GTCATGCTTG TCAAAGTATT
AACTTTGCAT GTCGAAATTA ACATGTGTGA ATGCAGATGC TGAACCATGG CATCGCGCAC GAGCTGATGG ACGAGGTGGA
GCGGGTGAGC AAGGCGCACT ACGCCAACTG CCGGGAGGAG AAGTTCAAGG AGTTCGCGCG GCGGATGCTG GAGGCCGGCG
AGAAGGGCGC CGACGTGAAG GGCATCGACT GGGAGAGCAC CTTCTTCGTC CGCCACCGCC CCGTCTCCAA CCTCGCCGAC
CTCCCCGACG TCGACGACCA CTACAGGTAT ACTTACCCTG CATGCATGCG TCATCATCAA TCATCATTAA CAAACTCAAT
TTAGTCTTTG TTAATTTATC TGCATGCTTC TGAAAGAAAA GCTTAAGTTG CAAACTCGCC TAAATGATCG TCAGTATTTT
AATCGGAAGT AGTACACTCA CAAAGCAAAG GCTTACAAAG TATCCTAGCT ACTGTAGAGT GTAGGCCTGA CCAAAACCTC
AACAAAGTTA CACCTGACAC GACGCGCTCT ACTATAGAAA TGCCCACTTC TGTAAACAGC TACTGCAACC AAAGGTGACA
GGATTATCGA CCAAAAGGAG ATGCTTACTT TTTTACTGCG GCTTATCCAC AGCGTCGATT ACTCTTGAAC GGACGTAGTG
GCGCATCTCT GCACCCTTTC CTACTATGAG ATAGTAACAA GTGTAGGAAT ACACCATTTT TTTTCTGTTT TCCCCCGGAG
AGGAGTATAC ATCATACAAC GTGCAGTAAC TATCAATCAA TCAGAACTCA CACTAACTGG ATTCGCTTTT GGCAAATGGC
AAGTGACTTG TGAATATTCG CGAGGCCTAA CAGAAGCCCA TGTGTCGCGT TTGTGTAGGC AGGTGATGAA GCAATTTGCG
TCGGAGATCG AGAAGCTCTC GGAGAGGGTG CTGGACCTGC TGTGCGAGAA TCTGGGCCTG GAGAAGGGTT ACCTGAAGAA
GGCCTTCGCC GGGTCGAACG GCCCAACGTT CGGCACCAAG GTGAGCAGCT ACCCGCCGTG CCCGCGCCCC GATCTCGTCG
ACGGCCTCCG CGCCCACACC GACGCCGGTG GCATCATCCT GCTGTTCCAG GACGACCAGG TGAGCGGCCT CCAGCTGCTC
AAGGACGGGG AGTGGGTGGA CGTGCCGCCC ATGCGCCACG CCATCGTCGC CAACATCGGC GACCAGCTGG AGGTGATCAC
CAACGGCAGG TACAAGAGCG TCATGCACCG CGTCCTCACG CGCCCCGACG GCAACCGCAT GTCCATCGCC TCCTTCTACA
ACCCCGGCGC CGACGCCGTC ATCTTCCCGG CGCCCGCGCT CGCCGCCGCC GACGCGGCGG CGGCCGCCTA CCCGAGGTTC
GTGTTCGAGG ACTACATGAA CCTGTACGTG CGCCACAAGT TCGAGGCCAA GGAGCCACGC TTCGAGGCCA TGAAGTCCGC
CGCCGAGGTC GTCCACGCGG CGCCCATCGC CACCGCTTGA TAAGGATCAG ACTTCACTAG CTACGGCTGC GCGTGCCATG
ATCCAGATAT ATGGGATGTG TACGGTAGTG TACGTGGTGC TGTACATGCC GTCCCGTGTT TTTCTGCGTA ATGTTTTTAC
GTACTAGACT ACTACTAGTG TGTGTACGTA ACCTGGGGAT GTAAGTATCG CGTCAAGTAC TCAAGTGTGT GTAACGGGCG
CTCTAATCGT ATTGTTCTGT GCTTCAATGG CTACCACGTT AGATGGGCCT TGTGCTAATG TTGTTTTATG CT

Locus: Os02g0771600

Loading...

Locus: Os02g0771600

Loading...