Os02t0771600-02

Locus

Os02g0771600

Description

ACC oxidase, Ethylene biosynthesis

RAP-DB Gene Symbol Synonym(s)

ACO3, OsACO3

RAP-DB Gene Name Synonym(s)

AMINOCYCLOPROPANE-1-CARBOXYLIC ACID OXIDASE 3, ACC oxidase 3

CGSNL Gene Symbol

ACO3

CGSNL Gene Name

AMINOCYCLOPROPANE-1-CARBOXYLIC ACID OXIDASE 3

Oryzabase Gene Symbol Synonym(s)

OsACO3, ACO2, OsACO2

Oryzabase Gene Name Synonym(s)

ACC oxidase 3

Transcript Evidence

AK071557

AK103969

Protein Evidence

Q6ZHG2

Literature

PMID: 17012402

Note

Manual Curation

November 26, 2009

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Isopenicillin N synthase-like (IPR027443)

Non-haem dioxygenase N-terminal domain (IPR026992)

Oxoglutarate/iron-dependent dioxygenase (IPR005123)

Full-length cDNA

001-016-B02 (Online Clone Ordering)

J023099D13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0771600-02)

RiceXPro (AK103969)

Others

Oryzabase (9073)

KEGG (Os02t0771600-02)

Transcript

1316 bp

>Os02t0771600-02 ACC oxidase, Ethylene biosynthesis
GTGCACACACAGACACACAGACGCACTCACACACTCAGCTTAAGCGAGCGAGCGAGTGAA
CGAGAGAGAGAGACAGAGATGGCGAGTGTTGCCTCCTTCCCGGTGATCAACATGGAGAAC
CTGGAGACCGAGGAGAGGGGCGCAGCAATGGAGGTCATCCGCGACGCCTGCGAGAACTGG
GGCTTCTTCGAGATGCTGAACCATGGCATCGCGCACGAGCTGATGGACGAGGTGGAGCGG
GTGAGCAAGGCGCACTACGCCAACTGCCGGGAGGAGAAGTTCAAGGAGTTCGCGCGGCGG
ATGCTGGAGGCCGGCGAGAAGGGCGCCGACGTGAAGGGCATCGACTGGGAGAGCACCTTC
TTCGTCCGCCACCGCCCCGTCTCCAACCTCGCCGACCTCCCCGACGTCGACGACCACTAC
AGGCAGGTGATGAAGCAATTTGCGTCGGAGATCGAGAAGCTCTCGGAGAGGGTGCTGGAC
CTGCTGTGCGAGAATCTGGGCCTGGAGAAGGGTTACCTGAAGAAGGCCTTCGCCGGGTCG
AACGGCCCAACGTTCGGCACCAAGGTGAGCAGCTACCCGCCGTGCCCGCGCCCCGATCTC
GTCGACGGCCTCCGCGCCCACACCGACGCCGGTGGCATCATCCTGCTGTTCCAGGACGAC
CAGGTGAGCGGCCTCCAGCTGCTCAAGGACGGGGAGTGGGTGGACGTGCCGCCCATGCGC
CACGCCATCGTCGCCAACATCGGCGACCAGCTGGAGGTGATCACCAACGGCAGGTACAAG
AGCGTCATGCACCGCGTCCTCACGCGCCCCGACGGCAACCGCATGTCCATCGCCTCCTTC
TACAACCCCGGCGCCGACGCCGTCATCTTCCCGGCGCCCGCGCTCGCCGCCGCCGACGCG
GCGGCGGCCGCCTACCCGAGGTTCGTGTTCGAGGACTACATGAACCTGTACGTGCGCCAC
AAGTTCGAGGCCAAGGAGCCACGCTTCGAGGCCATGAAGTCCGCCGCCGAGGTCGTCCAC
GCGGCGCCCATCGCCACCGCTTGATAAGGATCAGACTTCACTAGCTACGGCTGCGCGTGC
CATGATCCAGATATATGGGATGTGTACGGTAGTGTACGTGGTGCTGTACATGCCGTCCCG
TGTTTTTCTGCGTAATGTTTTTACGTACTAGACTACTACTAGTGTGTGTACGTAACCTGG
GGATGTAAGTATCGCGTCAAGTACTCAAGTGTGTGTAACGGGCGCTCTAATCGTATTGTT
CTGTGCTTCAATGGCTACCACGTTAGATGGGCCTTGTGCTAATGTTGTTTTATGCT

CDS

966 bp

>Os02t0771600-02 ACC oxidase, Ethylene biosynthesis
ATGGCGAGTGTTGCCTCCTTCCCGGTGATCAACATGGAGAACCTGGAGACCGAGGAGAGG
GGCGCAGCAATGGAGGTCATCCGCGACGCCTGCGAGAACTGGGGCTTCTTCGAGATGCTG
AACCATGGCATCGCGCACGAGCTGATGGACGAGGTGGAGCGGGTGAGCAAGGCGCACTAC
GCCAACTGCCGGGAGGAGAAGTTCAAGGAGTTCGCGCGGCGGATGCTGGAGGCCGGCGAG
AAGGGCGCCGACGTGAAGGGCATCGACTGGGAGAGCACCTTCTTCGTCCGCCACCGCCCC
GTCTCCAACCTCGCCGACCTCCCCGACGTCGACGACCACTACAGGCAGGTGATGAAGCAA
TTTGCGTCGGAGATCGAGAAGCTCTCGGAGAGGGTGCTGGACCTGCTGTGCGAGAATCTG
GGCCTGGAGAAGGGTTACCTGAAGAAGGCCTTCGCCGGGTCGAACGGCCCAACGTTCGGC
ACCAAGGTGAGCAGCTACCCGCCGTGCCCGCGCCCCGATCTCGTCGACGGCCTCCGCGCC
CACACCGACGCCGGTGGCATCATCCTGCTGTTCCAGGACGACCAGGTGAGCGGCCTCCAG
CTGCTCAAGGACGGGGAGTGGGTGGACGTGCCGCCCATGCGCCACGCCATCGTCGCCAAC
ATCGGCGACCAGCTGGAGGTGATCACCAACGGCAGGTACAAGAGCGTCATGCACCGCGTC
CTCACGCGCCCCGACGGCAACCGCATGTCCATCGCCTCCTTCTACAACCCCGGCGCCGAC
GCCGTCATCTTCCCGGCGCCCGCGCTCGCCGCCGCCGACGCGGCGGCGGCCGCCTACCCG
AGGTTCGTGTTCGAGGACTACATGAACCTGTACGTGCGCCACAAGTTCGAGGCCAAGGAG
CCACGCTTCGAGGCCATGAAGTCCGCCGCCGAGGTCGTCCACGCGGCGCCCATCGCCACC
GCTTGA

Protein

321 aa

>Os02t0771600-02 ACC oxidase, Ethylene biosynthesis
MASVASFPVINMENLETEERGAAMEVIRDACENWGFFEMLNHGIAHELMDEVERVSKAHY
ANCREEKFKEFARRMLEAGEKGADVKGIDWESTFFVRHRPVSNLADLPDVDDHYRQVMKQ
FASEIEKLSERVLDLLCENLGLEKGYLKKAFAGSNGPTFGTKVSSYPPCPRPDLVDGLRA
HTDAGGIILLFQDDQVSGLQLLKDGEWVDVPPMRHAIVANIGDQLEVITNGRYKSVMHRV
LTRPDGNRMSIASFYNPGADAVIFPAPALAAADAAAAAYPRFVFEDYMNLYVRHKFEAKE
PRFEAMKSAAEVVHAAPIATA*

5'UTR

chr02:32560319..32560396 (+ strand) : 78 bp

CDS

chr02:32560397..32560510 (+ strand) : 114 bp

chr02:32560832..32561061 (+ strand) : 230 bp

chr02:32561654..32562275 (+ strand) : 622 bp

3'UTR

chr02:32562276..32562547 (+ strand) : 272 bp

FASTA

>Os02t0771600-02 class=Sequence position=chr02:32560319..32562547 (+ strand)
GTGCACACAC AGACACACAG ACGCACTCAC ACACTCAGCT TAAGCGAGCG AGCGAGTGAA CGAGAGAGAG AGACAGAGAT
GGCGAGTGTT GCCTCCTTCC CGGTGATCAA CATGGAGAAC CTGGAGACCG AGGAGAGGGG CGCAGCAATG GAGGTCATCC
GCGACGCCTG CGAGAACTGG GGCTTCTTCG AGGTGCATAT GCATGCCAAG CACTAGCATG TACTAACCAG CAAAAAAATG
TTAATATGAT TCTAGCTAAT TCCTAAGTGG CCGCACAACT TATTGATATG TTTCGATTTT TTTTTGTTCA TCGAGCCACC
TATACGTACA TCGTTCTTTC TGGCCGAAAG GATGGAAACA TATTCTTATT CTCCATCTTA GTCAGTCGAC CCACCAATTC
AATCTTATCA TCTCAGTAGG CTCGCCGGCT AGAACGCCTA CTAATTAGCT TTGATTTGTC ATGCTTGTCA AAGTATTAAC
TTTGCATGTC GAAATTAACA TGTGTGAATG CAGATGCTGA ACCATGGCAT CGCGCACGAG CTGATGGACG AGGTGGAGCG
GGTGAGCAAG GCGCACTACG CCAACTGCCG GGAGGAGAAG TTCAAGGAGT TCGCGCGGCG GATGCTGGAG GCCGGCGAGA
AGGGCGCCGA CGTGAAGGGC ATCGACTGGG AGAGCACCTT CTTCGTCCGC CACCGCCCCG TCTCCAACCT CGCCGACCTC
CCCGACGTCG ACGACCACTA CAGGTATACT TACCCTGCAT GCATGCGTCA TCATCAATCA TCATTAACAA ACTCAATTTA
GTCTTTGTTA ATTTATCTGC ATGCTTCTGA AAGAAAAGCT TAAGTTGCAA ACTCGCCTAA ATGATCGTCA GTATTTTAAT
CGGAAGTAGT ACACTCACAA AGCAAAGGCT TACAAAGTAT CCTAGCTACT GTAGAGTGTA GGCCTGACCA AAACCTCAAC
AAAGTTACAC CTGACACGAC GCGCTCTACT ATAGAAATGC CCACTTCTGT AAACAGCTAC TGCAACCAAA GGTGACAGGA
TTATCGACCA AAAGGAGATG CTTACTTTTT TACTGCGGCT TATCCACAGC GTCGATTACT CTTGAACGGA CGTAGTGGCG
CATCTCTGCA CCCTTTCCTA CTATGAGATA GTAACAAGTG TAGGAATACA CCATTTTTTT TCTGTTTTCC CCCGGAGAGG
AGTATACATC ATACAACGTG CAGTAACTAT CAATCAATCA GAACTCACAC TAACTGGATT CGCTTTTGGC AAATGGCAAG
TGACTTGTGA ATATTCGCGA GGCCTAACAG AAGCCCATGT GTCGCGTTTG TGTAGGCAGG TGATGAAGCA ATTTGCGTCG
GAGATCGAGA AGCTCTCGGA GAGGGTGCTG GACCTGCTGT GCGAGAATCT GGGCCTGGAG AAGGGTTACC TGAAGAAGGC
CTTCGCCGGG TCGAACGGCC CAACGTTCGG CACCAAGGTG AGCAGCTACC CGCCGTGCCC GCGCCCCGAT CTCGTCGACG
GCCTCCGCGC CCACACCGAC GCCGGTGGCA TCATCCTGCT GTTCCAGGAC GACCAGGTGA GCGGCCTCCA GCTGCTCAAG
GACGGGGAGT GGGTGGACGT GCCGCCCATG CGCCACGCCA TCGTCGCCAA CATCGGCGAC CAGCTGGAGG TGATCACCAA
CGGCAGGTAC AAGAGCGTCA TGCACCGCGT CCTCACGCGC CCCGACGGCA ACCGCATGTC CATCGCCTCC TTCTACAACC
CCGGCGCCGA CGCCGTCATC TTCCCGGCGC CCGCGCTCGC CGCCGCCGAC GCGGCGGCGG CCGCCTACCC GAGGTTCGTG
TTCGAGGACT ACATGAACCT GTACGTGCGC CACAAGTTCG AGGCCAAGGA GCCACGCTTC GAGGCCATGA AGTCCGCCGC
CGAGGTCGTC CACGCGGCGC CCATCGCCAC CGCTTGATAA GGATCAGACT TCACTAGCTA CGGCTGCGCG TGCCATGATC
CAGATATATG GGATGTGTAC GGTAGTGTAC GTGGTGCTGT ACATGCCGTC CCGTGTTTTT CTGCGTAATG TTTTTACGTA
CTAGACTACT ACTAGTGTGT GTACGTAACC TGGGGATGTA AGTATCGCGT CAAGTACTCA AGTGTGTGTA ACGGGCGCTC
TAATCGTATT GTTCTGTGCT TCAATGGCTA CCACGTTAGA TGGGCCTTGT GCTAATGTTG TTTTATGCT

Locus: Os02g0771600

Loading...

Locus: Os02g0771600

Loading...