Os02t0771700-01

Locus

Os02g0771700

Description

Glycoside hydrolase, family 17 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GNS9

CGSNL Gene Name

BETA-1,3-GLUCANASE 9

Oryzabase Gene Symbol Synonym(s)

Gns9, OsGns9

Oryzabase Gene Name Synonym(s)

beta-1, 3-glucanase 9

Transcript Evidence

AK058571 (DDBJ, Best hit)

AK102185 (DDBJ, Best hit)

Protein Evidence

Q9ZNY6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 17 (IPR000490)

X8 (IPR012946)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

001-017-E08 (Online Clone Ordering)

J033086N13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0771700-01)

RiceXPro (AK058571)

Others

Oryzabase (13927)

KEGG (Os02t0771700-01)

Transcript

1921 bp

>Os02t0771700-01 Glycoside hydrolase, family 17 protein.
ACTCACCACGCTCTCCACTACACGACTCGTCGCCGTCTTGCTCTGCTGCCTCTCGCGCCC
GCGCAGCAGTGAGCAGCAGCAAGAGCAGCAAAATGGCTCTACCCGGGCGCCTCCGCGCCC
TCATCCTCGCCGTCGCATTGCCGCTGCTCTTCCTGTCCGCTTCAGaggcgggcacggtgg
ggatcaactatgggagggtggcgaacgacctgcccaacccggcggcggtggtgcagctga
tgaagcagcagggcatcgcgcaggtgaagctgtacgacaccgagccgaccgtgctgcggg
cgctggccaacaccggcatcaaggtggtggtcgcgctgcccaacgagcagctgctcgccg
cggcgtcgcgcccgtcgtacgcgctcgcctgggtgcgccgcaacgtcgcagcgtactacc
cggccacgcagatccagggcatcgccgtcgggaacgaggtgttcgcctcggccaagaacc
tcacggcgcagctcgtcccggcgatgaccaacgtgcacgccgcgctggcgaggctcagcc
ttgacaagcccgtcaaggtgtcgtcccccatcgcgctcaccgcgctcgccggctcgtacc
cgccgtcggccggcgtgttccgggaggacctcgcccaggcggtcatgaagcccatgctcg
acttcctcgcgcagaccggctcgtacctcatggtgaacgcgtacccgttcttcgcgtact
ctggcaatgccgacgtcatctccctcgactacgcgctgttccgccccaacgccggcgtgc
tcgactccgggagcggcctcaagtactacagcctcctcgacgcccagctcgacgccgtgt
tcaccgcggtgagcaagcttgggaactacaatgccgtgcgcgtcgtggtgtcggagaccg
ggtggccgtccaagggtgacgccaaggagaccggcgccgcggcggccaacgccgcggcct
acaacggcaacctggtgcgccgcgtcctctccggcaacgccggaacgccgcgccgccccg
acgccgacatggacgtgtacctcttcgctctcttcaacgagaaccagaagcccggaccga
cctccgagcgcaactacggcgtgttctacccgaaccagCAGAAGGTCTACGACGTCGAGT
TCGTCCTCGGCGGCAACTCCGCTGGCGGCGGCGGCAGCAGCGGCAAGGACAACGGCGGGC
TCGGCTGGCAGGACAACGGCGGGGTAAACGCCGGCAATGCGCCGGCCGGCGCAGGCGGCG
GCGTGAAGGCGACGTCGACCGGTGAGGCGTGGTGCGTGGCGAACGCCATGGCCGGGGAGG
AGCGGCTGCAGAAGGCGCTGGACTACGCGTGCGGGCCGGGCGGCGCGGACTGCAAGGCCA
TCCAGCCCGGCGCGGCGTGCTTCGAGCCGAACACCATGGTCGCCCACGCCTCCTACGCCT
TCAACGACTACTACCAGCGAAAGGGCCGCACCATTGGCACCTGCGACTTCGCCGGCGCCG
CCTACGTCGTCAACCAAGCGCCAAAGATGGGCAAGTGTGAGCTCCCGTCGACGGTCTGAA
CCGAAGCAACAGTAGCGAAAGACTGAAGAAGAGCAGCGGCAGCAGCCATCTCGGGATGCG
AGGATTTATGAAAGAAAATCGAACGCCGGACAGAGGAAGGAGGGAAAAGAGGCAGAGATG
TTGGAATCTTTGCTTTTCTTTTCCAGTTTTCCTCCCTTTCTTTACCTGTGGTGCTGTGCC
CGCTGCTTGACTCCTGCTGCATGTTTGCTGCGGCGTAGAAACAGATTACTGTAGTAGCTG
TACCTCTTTCTTTTTGCAGCTTTGGCTAATGGTGGGGGATATCTTTGTTTAGTCCATGTA
ACTACGCTGGAGTATGGAGTATTACTATATGATTAACCTAAATCACTACTATTATAGACT
G

CDS

1467 bp

>Os02t0771700-01 Glycoside hydrolase, family 17 protein.
ATGGCTCTACCCGGGCGCCTCCGCGCCCTCATCCTCGCCGTCGCATTGCCGCTGCTCTTC
CTGTCCGCTTCAGaggcgggcacggtggggatcaactatgggagggtggcgaacgacctg
cccaacccggcggcggtggtgcagctgatgaagcagcagggcatcgcgcaggtgaagctg
tacgacaccgagccgaccgtgctgcgggcgctggccaacaccggcatcaaggtggtggtc
gcgctgcccaacgagcagctgctcgccgcggcgtcgcgcccgtcgtacgcgctcgcctgg
gtgcgccgcaacgtcgcagcgtactacccggccacgcagatccagggcatcgccgtcggg
aacgaggtgttcgcctcggccaagaacctcacggcgcagctcgtcccggcgatgaccaac
gtgcacgccgcgctggcgaggctcagccttgacaagcccgtcaaggtgtcgtcccccatc
gcgctcaccgcgctcgccggctcgtacccgccgtcggccggcgtgttccgggaggacctc
gcccaggcggtcatgaagcccatgctcgacttcctcgcgcagaccggctcgtacctcatg
gtgaacgcgtacccgttcttcgcgtactctggcaatgccgacgtcatctccctcgactac
gcgctgttccgccccaacgccggcgtgctcgactccgggagcggcctcaagtactacagc
ctcctcgacgcccagctcgacgccgtgttcaccgcggtgagcaagcttgggaactacaat
gccgtgcgcgtcgtggtgtcggagaccgggtggccgtccaagggtgacgccaaggagacc
ggcgccgcggcggccaacgccgcggcctacaacggcaacctggtgcgccgcgtcctctcc
ggcaacgccggaacgccgcgccgccccgacgccgacatggacgtgtacctcttcgctctc
ttcaacgagaaccagaagcccggaccgacctccgagcgcaactacggcgtgttctacccg
aaccagCAGAAGGTCTACGACGTCGAGTTCGTCCTCGGCGGCAACTCCGCTGGCGGCGGC
GGCAGCAGCGGCAAGGACAACGGCGGGCTCGGCTGGCAGGACAACGGCGGGGTAAACGCC
GGCAATGCGCCGGCCGGCGCAGGCGGCGGCGTGAAGGCGACGTCGACCGGTGAGGCGTGG
TGCGTGGCGAACGCCATGGCCGGGGAGGAGCGGCTGCAGAAGGCGCTGGACTACGCGTGC
GGGCCGGGCGGCGCGGACTGCAAGGCCATCCAGCCCGGCGCGGCGTGCTTCGAGCCGAAC
ACCATGGTCGCCCACGCCTCCTACGCCTTCAACGACTACTACCAGCGAAAGGGCCGCACC
ATTGGCACCTGCGACTTCGCCGGCGCCGCCTACGTCGTCAACCAAGCGCCAAAGATGGGC
AAGTGTGAGCTCCCGTCGACGGTCTGA

Protein

489 aa

>Os02t0771700-01 Glycoside hydrolase, family 17 protein.
MALPGRLRALILAVALPLLFLSASEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQVKL
YDTEPTVLRALANTGIKVVVALPNEQLLAAASRPSYALAWVRRNVAAYYPATQIQGIAVG
NEVFASAKNLTAQLVPAMTNVHAALARLSLDKPVKVSSPIALTALAGSYPPSAGVFREDL
AQAVMKPMLDFLAQTGSYLMVNAYPFFAYSGNADVISLDYALFRPNAGVLDSGSGLKYYS
LLDAQLDAVFTAVSKLGNYNAVRVVVSETGWPSKGDAKETGAAAANAAAYNGNLVRRVLS
GNAGTPRRPDADMDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGNSAGGG
GSSGKDNGGLGWQDNGGVNAGNAPAGAGGGVKATSTGEAWCVANAMAGEERLQKALDYAC
GPGGADCKAIQPGAACFEPNTMVAHASYAFNDYYQRKGRTIGTCDFAGAAYVVNQAPKMG
KCELPSTV*

5'UTR

chr02:32569951..32570042 (- strand) : 92 bp

CDS

chr02:32569878..32569950 (- strand) : 73 bp

chr02:32568444..32569802 (- strand) : 1359 bp

chr02:32567440..32567474 (- strand) : 35 bp

3'UTR

chr02:32567078..32567439 (- strand) : 362 bp

FASTA

>Os02t0771700-01 class=Sequence position=chr02:32567078..32570042 (- strand)
ACTCACCACG CTCTCCACTA CACGACTCGT CGCCGTCTTG CTCTGCTGCC TCTCGCGCCC GCGCAGCAGT GAGCAGCAGC
AAGAGCAGCA AAATGGCTCT ACCCGGGCGC CTCCGCGCCC TCATCCTCGC CGTCGCATTG CCGCTGCTCT TCCTGTCCGC
TTCAGGTAAC GAGAGATTTG GCAATGCAGG TGGTTTAGTG GAGAGTAGTG tggttgattg ttgggttggt ttggttacag
aggcgggcac ggtggggatc aactatggga gggtggcgaa cgacctgccc aacccggcgg cggtggtgca gctgatgaag
cagcagggca tcgcgcaggt gaagctgtac gacaccgagc cgaccgtgct gcgggcgctg gccaacaccg gcatcaaggt
ggtggtcgcg ctgcccaacg agcagctgct cgccgcggcg tcgcgcccgt cgtacgcgct cgcctgggtg cgccgcaacg
tcgcagcgta ctacccggcc acgcagatcc agggcatcgc cgtcgggaac gaggtgttcg cctcggccaa gaacctcacg
gcgcagctcg tcccggcgat gaccaacgtg cacgccgcgc tggcgaggct cagccttgac aagcccgtca aggtgtcgtc
ccccatcgcg ctcaccgcgc tcgccggctc gtacccgccg tcggccggcg tgttccggga ggacctcgcc caggcggtca
tgaagcccat gctcgacttc ctcgcgcaga ccggctcgta cctcatggtg aacgcgtacc cgttcttcgc gtactctggc
aatgccgacg tcatctccct cgactacgcg ctgttccgcc ccaacgccgg cgtgctcgac tccgggagcg gcctcaagta
ctacagcctc ctcgacgccc agctcgacgc cgtgttcacc gcggtgagca agcttgggaa ctacaatgcc gtgcgcgtcg
tggtgtcgga gaccgggtgg ccgtccaagg gtgacgccaa ggagaccggc gccgcggcgg ccaacgccgc ggcctacaac
ggcaacctgg tgcgccgcgt cctctccggc aacgccggaa cgccgcgccg ccccgacgcc gacatggacg tgtacctctt
cgctctcttc aacgagaacc agaagcccgg accgacctcc gagcgcaact acggcgtgtt ctacccgaac cagCAGAAGG
TCTACGACGT CGAGTTCGTC CTCGGCGGCA ACTCCGCTGG CGGCGGCGGC AGCAGCGGCA AGGACAACGG CGGGCTCGGC
TGGCAGGACA ACGGCGGGGT AAACGCCGGC AATGCGCCGG CCGGCGCAGG CGGCGGCGTG AAGGCGACGT CGACCGGTGA
GGCGTGGTGC GTGGCGAACG CCATGGCCGG GGAGGAGCGG CTGCAGAAGG CGCTGGACTA CGCGTGCGGG CCGGGCGGCG
CGGACTGCAA GGCCATCCAG CCCGGCGCGG CGTGCTTCGA GCCGAACACC ATGGTCGCCC ACGCCTCCTA CGCCTTCAAC
GACTACTACC AGCGAAAGGG CCGCACCATT GGCACCTGCG ACTTCGCCGG CGCCGCCTAC GTCGTCAACC AAGCGCCAAG
TGAGTAGTCT TCGCGCTCGT TTGCTCGTAC AATTACCTCA TTGCATTCGT ACTACTTCTA CATGATTCCT TGCGTTTCGT
AGCGAAATGT ACGTGTTATA CGAACGGGTG TAGGGCTTGG TACACGCTAG TACACGTTAC ACAACCTGGA TTGGGCCATC
GTGTTCCGGT AAAAGTTTGC GTAGGAACTA CTACTACTTG TACATGGTGA TTCACAGATG GGTGGGTCAC AGTACGGGTG
CAAATGAAAG GCGCTTTGCA TCGGCATCGT ACGGGAATGA TTCTCGCTTC ACTGTAGTCT TCGCAGCCAC ACACTGGCAT
GTGCCACACG ATTCACACCC ATGGCTTCCT GCCTGGGTTA AACACACCTT GGAAAGACGC AGCCGGCGGT TGCAACTTGC
AAAATTGCGA CTGCAAGCAG CCGCTACTGT GTCTCTGTGA CCAACAAATC TTCACTGCGG TTTTGAGGTC TCGTTGCATT
GGATTCGAGC TGTAGGTGTT CTGCTTCTTC TGCATTGCAC TGCGGTAGTT AATGAGTGGC TCAGCAAGTT GTAAACCCGC
ACAAGTGCAA TTATGACTGC GATGAGATGG GGTCAGCGTG GCTCGCAGCT CGACGTGATA TGACTCGTCC TGTATTCTTT
ACTCCCTTCA TTCATGGTGA TGCGTGCCGT GGCTGGATGT CGCAGGCTCG CAACGTGTGA CTGATTGCCA CTATCGTGTC
GTGTACCTTT TGCAGTTCGT ACTCCTACTA CCTGCATCAA TTTTTTTACA GTATTCCTCC ACTTGTTATT CCCTCGGTTA
CCGCCAGTAT ACGCGTCTCC TCCTTTGGAC CAGCACTACA ATTGGTCTCT TGTTCACATG ATAGCAGCGA TTTACCAGTT
TTTTAATCGC GTAATACCAC CCTGTTGTAT GATTCTTTCT TTTTGAACCG TGATCTTACT GGGTGATTGT CTATTCCATT
GTTTGCAGAG ATGGGCAAGT GTGAGCTCCC GTCGACGGTC TGAACCGAAG CAACAGTAGC GAAAGACTGA AGAAGAGCAG
CGGCAGCAGC CATCTCGGGA TGCGAGGATT TATGAAAGAA AATCGAACGC CGGACAGAGG AAGGAGGGAA AAGAGGCAGA
GATGTTGGAA TCTTTGCTTT TCTTTTCCAG TTTTCCTCCC TTTCTTTACC TGTGGTGCTG TGCCCGCTGC TTGACTCCTG
CTGCATGTTT GCTGCGGCGT AGAAACAGAT TACTGTAGTA GCTGTACCTC TTTCTTTTTG CAGCTTTGGC TAATGGTGGG
GGATATCTTT GTTTAGTCCA TGTAACTACG CTGGAGTATG GAGTATTACT ATATGATTAA CCTAAATCAC TACTATTATA
GACTG

Locus: Os02g0771700

Loading...

Locus: Os02g0771700

Loading...